TDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRALE
VQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHR
The query sequence (length=136) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3h87:A | 136 | 136 | 1.0000 | 1.0000 | 1.0000 | 6.47e-97 | |
2 | 1ud9:A | 242 | 63 | 0.1544 | 0.0868 | 0.3333 | 0.002 | 1ud9:B, 1ud9:C, 1ud9:D |
3 | 4chg:A | 133 | 46 | 0.1324 | 0.1353 | 0.3913 | 0.22 | 4chg:B, 4chg:E, 4chg:D, 4chg:F |
4 | 5ex2:A | 267 | 46 | 0.1250 | 0.0637 | 0.3696 | 3.3 | 5ex2:B |
5 | 1vg0:A | 481 | 24 | 0.0882 | 0.0249 | 0.5000 | 4.1 | |
6 | 7oik:A | 4426 | 58 | 0.1397 | 0.0043 | 0.3276 | 6.4 | 7oim:A, 6tax:A, 6tay:A |
7 | 2zu2:B | 301 | 31 | 0.0882 | 0.0399 | 0.3871 | 7.2 | 8im6:A, 8im6:B, 7yrz:A, 7yrz:B, 2zu2:A |
8 | 4h9d:A | 97 | 14 | 0.0588 | 0.0825 | 0.5714 | 9.8 | 4h9d:B, 4h9d:C |