BioLiP

>protein
TAYGCDITTNAVDGFDATIYQYNANDLRLIRDPTFMSTGYLGRNVLNKISGVTVPGFNIWNPSSRTATVYGVKNVNYYNM
VLELKGYFKADVSGDYKLTLSHIDDSSMLFFGKETAFKCCDAGSIPLNEAPTDYSLFTIKPSNQVNSEVISATQYLEAGK
YYPVRIVFVNALERARFDFKLTIPSGAVLDDFQNYIYQFGDL

The query sequence (length=202) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5a3l:A	209	202	1.0000	0.9665	1.0000	8.99e-151	5a3l:B, 5a3l:C, 5a3l:D, 5a3m:A, 5a3m:B, 5a3m:C, 5a3m:D
2	6hos:A	213	205	0.5990	0.5681	0.5902	5.60e-82	6hos:B
3	4gq7:A	220	196	0.3069	0.2818	0.3163	5.65e-29	4lhk:A, 4lhk:B
4	2xjp:A	258	221	0.2871	0.2248	0.2624	1.63e-20	4lhn:A, 2xjr:A, 2xjs:A, 2xjt:A, 2xju:A, 2xjv:A
5	6y9j:A	231	180	0.2475	0.2165	0.2778	4.61e-10	4a3x:A, 4af9:A, 4afa:A, 4afb:A, 4afc:A, 4asl:A, 4d3w:A
6	4coy:A	232	179	0.2574	0.2241	0.2905	5.00e-09	4cou:A, 4cov:A, 4cow:A, 4coz:A
7	6y98:A	225	140	0.2030	0.1822	0.2929	5.30e-09	4cp0:A, 4cp1:A, 4cp2:A
8	4pv4:A	436	118	0.1287	0.0596	0.2203	0.64	4pv4:B
9	5brp:A	555	95	0.1238	0.0450	0.2632	1.3	5brp:B, 5brp:C, 5brp:D, 5brq:A, 5brq:B, 5brq:C, 5brq:D
10	3dza:C	175	43	0.0693	0.0800	0.3256	1.7
11	5hxm:A	1060	61	0.0891	0.0170	0.2951	4.6	5f7u:A, 5hpo:A, 5i0d:A, 5i0d:B, 4kmq:A, 4kwu:A
12	1d7o:A	297	46	0.0545	0.0370	0.2391	7.2	1cwu:A, 1cwu:B, 1eno:A, 1enp:A
13	7pao:9	682	42	0.0594	0.0176	0.2857	7.4	7paq:9, 7par:9, 7pib:9, 7pis:9, 7pit:9
14	3igy:B	549	66	0.1040	0.0383	0.3182	7.9	3igz:B

[Back]