TATPERFSVLGTTHPKPKRTGFGRNNKMRSKPSDNVAWYDKGPVEWLPRPVRLTYDHLDQLQQWTMRATLDGRTEEFNRI
RDLHREWSQHPLMPVLGDVEPKFPLNLFKQNHRAKKRFLVRWHKANTPANWLWMPRGPTVVTPLHRTNPTQYPENWKQMV
Q
The query sequence (length=161) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7aor:ax | 161 | 161 | 0.9193 | 0.9193 | 0.9193 | 2.72e-111 | 6hiv:DW, 6hiw:DW, 6hiz:DW, 7pua:DW, 7pub:DW, 6sg9:DW, 6sgb:DW |
2 | 7ane:ax | 161 | 161 | 0.8137 | 0.8137 | 0.8137 | 2.85e-100 | |
3 | 7qqg:D | 496 | 62 | 0.1366 | 0.0444 | 0.3548 | 0.47 | |
4 | 7qqg:B | 623 | 62 | 0.1366 | 0.0353 | 0.3548 | 0.55 | 7qqg:A, 7qqg:C, 7qqh:A, 7qqh:B, 7qqh:C, 7qqh:D |
5 | 5hyn:A | 581 | 60 | 0.1180 | 0.0327 | 0.3167 | 3.2 | 5hyn:F, 5hyn:K, 5hyn:Q, 5ls6:A, 5ls6:G, 5ls6:J, 5ls6:D |
6 | 1nyq:B | 645 | 62 | 0.1180 | 0.0295 | 0.3065 | 4.6 | 1nyq:A, 1nyr:A, 1nyr:B |
7 | 5hq4:A | 662 | 55 | 0.0932 | 0.0227 | 0.2727 | 5.1 | 5hqa:A, 5hqb:A, 5hqc:A |
8 | 6az1:B | 211 | 40 | 0.0932 | 0.0711 | 0.3750 | 6.6 | 8a3w:SB, 8a98:SB, 8ovj:SB, 8rxh:SB, 8rxx:SB, 5t2a:AC |
9 | 7s7t:A | 509 | 40 | 0.0807 | 0.0255 | 0.3250 | 7.8 | 8i4o:A, 8i4o:C, 8i4o:E, 8i4o:G, 8i4o:I, 8i4o:K |
10 | 4f0l:B | 449 | 33 | 0.0807 | 0.0290 | 0.3939 | 8.1 | 4f0l:A |