Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
TATPEKFSILGTTHPKPKRNGMGRNNKMRSKPSDNVAWYDKGPVEWLPRPVRLTYDQLDQLRDWMMRETIAGRTEEFNKI
RHLHREWSQHPLMPVLGDVEPKFPLNLYKQNHRAKRRFLVRWHKANSPTYWMWMPRGPAVATPLHRSSPSQFPEHWKSLA
R

The query sequence (length=161) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7ane:ax 161 161 1.0000 1.0000 1.0000 3.84e-119
2 7aor:ax 161 161 0.8385 0.8385 0.8385 1.59e-102 6hiv:DW, 6hiw:DW, 6hiz:DW, 7pua:DW, 7pub:DW, 6sg9:DW, 6sgb:DW
3 7qqg:D 496 42 0.0932 0.0302 0.3571 0.98
4 7qqg:B 623 42 0.0932 0.0241 0.3571 1.0 7qqg:A, 7qqg:C, 7qqh:A, 7qqh:B, 7qqh:C, 7qqh:D
5 6wy8:B 384 126 0.1863 0.0781 0.2381 2.0 6wy8:D, 6wy9:A
6 2x6t:G 308 33 0.0621 0.0325 0.3030 3.5 1eq2:B, 1eq2:D, 1eq2:E, 1eq2:F, 1eq2:G, 1eq2:H, 1eq2:I, 1eq2:J, 2x6t:A, 2x6t:B, 2x6t:C, 2x6t:D, 2x6t:E, 2x6t:F, 2x6t:H, 2x6t:I, 2x6t:J, 2x86:A, 2x86:B, 2x86:C, 2x86:D, 2x86:E, 2x86:F, 2x86:G, 2x86:H, 2x86:I, 2x86:J, 2x86:K, 2x86:L, 2x86:M, 2x86:N, 2x86:O, 2x86:P, 2x86:Q, 2x86:R, 2x86:S, 2x86:T

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218