BioLiP

>protein
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHV
DYIEEDSSVFAQ

The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6u2f:A	582	92	1.0000	0.1581	1.0000	2.05e-60	7kev:A, 7kfa:A, 4ne9:B, 4nmx:B, 5oca:A, 3p5b:A, 3p5c:A, 2qtw:B, 7s5g:B, 7s5h:B, 6u2p:B, 6u36:B, 6u38:B, 6u3i:A, 6u3x:B, 5vla:A, 5vlh:A, 5vlk:A, 5vll:A, 5vlp:A, 2w2m:A, 2w2n:A, 2w2q:A, 6xib:B, 6xic:B, 6xid:B, 6xie:B, 6xif:B, 2xtj:A
2	8jxu:A	1410	57	0.1957	0.0128	0.3158	0.23	8jxq:A
3	6w80:A	430	76	0.2391	0.0512	0.2895	2.1
4	7bc4:B	2054	36	0.1413	0.0063	0.3611	2.7
5	5ae6:B	767	40	0.1522	0.0183	0.3500	3.8	5a7m:A, 5a7m:B, 5ae6:A
6	1b4u:B	298	50	0.1739	0.0537	0.3200	4.0	1b4u:D, 1bou:B, 1bou:D
7	5mif:C	301	50	0.1630	0.0498	0.3000	4.2	5mif:D
8	4apb:D	462	62	0.2174	0.0433	0.3226	5.0	4adl:A, 4adl:C, 4adl:B, 4adl:D, 4apb:A, 4apb:C, 4apb:B, 5f91:A, 5f91:C, 6s43:A, 6s43:C, 6s7k:A, 6s7k:C, 6s7s:A, 6s7s:C, 6s7u:A, 6s7u:C, 6s7w:A, 6s7w:C, 6s7z:A, 6s7z:C, 6s88:A, 6s88:C
9	1br2:A	673	54	0.1957	0.0267	0.3333	5.1	1br2:B, 1br2:C, 1br2:D, 1br2:E, 1br2:F
10	5t45:A	708	54	0.1957	0.0254	0.3333	5.1	5m05:A
11	3rku:A	268	27	0.0978	0.0336	0.3333	5.6	3rku:B, 3rku:C, 3rku:D
12	7mf3:B	896	54	0.1957	0.0201	0.3333	7.9	1br1:A, 1br1:C, 1br1:E, 1br1:G, 1br4:A, 1br4:C, 1br4:E, 1br4:G, 7mf3:A, 6z47:A, 6z47:B

[Back]