TASVALIENLQREELSSIEEAHAYARLLELHDLTQEALAQRLGKGQSTIANKLRLLKLPQPVQEAIMEKKITERHARALI
PLKQPELQVTLLTEIIEKSLNVKQTEDRVVKMLEQG
The query sequence (length=116) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ol9:B | 203 | 116 | 1.0000 | 0.5714 | 1.0000 | 1.52e-76 | 7ol9:A, 6y93:A, 6y93:B |
2 | 1vz0:B | 192 | 103 | 0.4828 | 0.2917 | 0.5437 | 5.46e-26 | 1vz0:A, 1vz0:C, 1vz0:D |
3 | 6sdk:A | 199 | 103 | 0.4483 | 0.2613 | 0.5049 | 4.65e-24 | 6sdk:B, 6sdk:C, 6sdk:D |
4 | 7bnr:B | 196 | 104 | 0.4138 | 0.2449 | 0.4615 | 2.86e-22 | 7bnk:A, 7bnk:B, 7bnr:A, 7o0n:A, 7o0n:B |
5 | 4umk:D | 176 | 104 | 0.4224 | 0.2784 | 0.4712 | 6.38e-22 | 4umk:A |
6 | 6s6h:B | 140 | 103 | 0.3707 | 0.3071 | 0.4175 | 2.54e-13 | |
7 | 6t1f:C | 195 | 103 | 0.3707 | 0.2205 | 0.4175 | 6.78e-13 | 7bm8:A, 7bm8:B, 6s6h:A, 6t1f:A, 6t1f:B, 6t1f:D |
8 | 8qa8:B | 202 | 68 | 0.1810 | 0.1040 | 0.3088 | 0.061 | 8qa8:A, 8qa8:C, 8qa8:D, 8qa8:E, 8qa8:F, 1r71:A, 1r71:B, 1r71:C, 1r71:D |
9 | 7tdv:C | 443 | 67 | 0.2069 | 0.0542 | 0.3582 | 0.45 | 7tdv:A, 7tdv:D, 7tdv:E, 7tdv:B, 7tdv:H, 7tf6:C, 7tf6:O, 7tf6:R, 7tf6:F, 7tf6:N, 7tf6:H, 7tf6:L, 7tf6:T, 7tf6:A, 7tf6:S, 7tf6:G, 7tf6:B |
10 | 4c0b:B | 430 | 40 | 0.1293 | 0.0349 | 0.3750 | 1.6 | 4c0b:A, 4c0h:A, 2npi:A, 2npi:B, 4oi4:A, 4oi4:C |
11 | 7l1k:B | 660 | 69 | 0.1466 | 0.0258 | 0.2464 | 1.6 | |
12 | 1tyo:A | 427 | 43 | 0.1293 | 0.0351 | 0.3488 | 1.9 | 1xkd:A, 1xkd:B |
13 | 6ayh:A | 192 | 61 | 0.1638 | 0.0990 | 0.3115 | 1.9 | |
14 | 6b9t:D | 453 | 66 | 0.1724 | 0.0442 | 0.3030 | 2.9 | 6b9s:A, 6b9s:D, 6b9s:C, 6b9s:G, 6b9s:E, 6b9t:A, 6b9t:B, 6b9t:C, 6b9t:E, 6b9t:F, 6b9t:G, 6b9t:H |
15 | 8h2w:B | 984 | 39 | 0.1207 | 0.0142 | 0.3590 | 3.3 | 8h2w:A, 5nz8:B |
16 | 4jcw:B | 202 | 22 | 0.0603 | 0.0347 | 0.3182 | 4.1 | 4jcw:A, 4l48:A, 4l48:C |
17 | 5z87:A | 756 | 79 | 0.1638 | 0.0251 | 0.2405 | 4.4 | 5z87:B |
18 | 7pub:CJ | 803 | 29 | 0.1121 | 0.0162 | 0.4483 | 4.4 | 6hiv:CJ, 6hiw:CJ, 6hiz:CJ, 7pua:CJ |
19 | 8ebw:H | 532 | 59 | 0.1552 | 0.0338 | 0.3051 | 4.5 | 8ebs:H, 8ebt:H, 8ebv:H, 8ebx:H |
20 | 6z1p:BD | 107 | 26 | 0.0862 | 0.0935 | 0.3846 | 5.4 | |
21 | 5jb2:A | 670 | 85 | 0.2155 | 0.0373 | 0.2941 | 6.4 | 5jaj:A, 5jbg:A |
22 | 7aor:e | 810 | 27 | 0.0948 | 0.0136 | 0.4074 | 6.8 | |
23 | 6ikg:A | 644 | 29 | 0.0948 | 0.0171 | 0.3793 | 7.3 | 6ikg:B |