TAPVTVFAAASLKESMDEAATAYEKATGTPVRVSYAASSALARQIEQGAPADVFLSADLEWMDYLQQHGLVLPAQRHNLL
GNTLVLVAPASSKLRVDPRAPGAIAKALGENGRLAVGQTASVPAGKYAAAALRKLGQWDSVSNRLAESESVRAALMLVSR
GEAPLGIVYGSDARADAKVRVVATFPDDSHDAIVYPVAALKNSNNPATAAFVSWLGSKPAKAIFARRGFSLK
The query sequence (length=232) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2h5y:B | 233 | 232 | 1.0000 | 0.9957 | 1.0000 | 9.22e-168 | 3gzg:A, 3gzg:B, 3gzg:C, 2h5y:A, 2h5y:C |
2 | 1amf:A | 231 | 232 | 0.5172 | 0.5195 | 0.5172 | 1.93e-72 | 3axf:A, 3axf:B, 3axf:C, 3r26:A, 1wod:A, 4xxu:A, 4xxu:B |
3 | 8k8l:A | 231 | 236 | 0.5216 | 0.5238 | 0.5127 | 3.51e-69 | |
4 | 4rxl:A | 229 | 224 | 0.3966 | 0.4017 | 0.4107 | 1.15e-48 | |
5 | 4kd5:C | 229 | 231 | 0.3448 | 0.3493 | 0.3463 | 1.34e-38 | |
6 | 7tav:B | 229 | 231 | 0.3147 | 0.3188 | 0.3160 | 3.34e-29 | 7tav:C, 7tav:F |
7 | 7t5a:A | 230 | 231 | 0.3233 | 0.3261 | 0.3247 | 1.96e-20 | 7t50:A, 7t50:B, 7t51:A, 7t51:B, 7t5a:B |
8 | 1atg:A | 231 | 238 | 0.2931 | 0.2944 | 0.2857 | 6.61e-11 | |
9 | 1d9y:A | 309 | 73 | 0.1121 | 0.0841 | 0.3562 | 0.045 | 1o7t:A, 1o7t:B, 1o7t:C, 1o7t:D, 1o7t:E, 1o7t:F, 1o7t:G, 1o7t:H, 1o7t:I, 1r1n:A, 1r1n:B, 1r1n:C, 1r1n:D, 1r1n:E, 1r1n:F, 1r1n:G, 1r1n:H, 1r1n:I, 1xc1:A, 1xc1:B, 1xc1:C, 1xc1:D, 1xc1:E, 1xc1:F, 1xc1:G, 1xc1:H, 1xc1:I |
10 | 3e13:X | 317 | 59 | 0.0733 | 0.0536 | 0.2881 | 0.12 | 1y4t:A, 1y4t:D |
11 | 2gh9:A | 378 | 77 | 0.0862 | 0.0529 | 0.2597 | 0.14 | |
12 | 1d9v:A | 309 | 79 | 0.1078 | 0.0809 | 0.3165 | 0.15 | 3kn7:A, 3kn8:A, 1mrp:A, 1nnf:A, 2o68:A, 3od7:A, 3odb:A |
13 | 7li0:A | 312 | 31 | 0.0603 | 0.0449 | 0.4516 | 0.43 | 7li0:B, 7li1:A, 7li1:B, 7li1:C, 7li1:D |
14 | 4ici:A | 159 | 40 | 0.0690 | 0.1006 | 0.4000 | 1.6 | |
15 | 7myv:B | 239 | 86 | 0.1121 | 0.1088 | 0.3023 | 1.8 | 7myv:A |
16 | 4j8p:A | 156 | 42 | 0.0647 | 0.0962 | 0.3571 | 2.4 | |
17 | 5zbh:A | 461 | 86 | 0.0905 | 0.0456 | 0.2442 | 2.7 | |
18 | 4lxh:A | 276 | 76 | 0.0690 | 0.0580 | 0.2105 | 5.2 | 4lxi:A, 4lye:A |
19 | 8iqu:A | 545 | 81 | 0.1034 | 0.0440 | 0.2963 | 6.4 | 8hd4:A, 8hdf:A |
20 | 1b1x:A | 689 | 34 | 0.0603 | 0.0203 | 0.4118 | 7.6 | 1b7z:A, 3cr9:A, 1f9b:A, 1qjm:A |