TAKYELIGLMAYPIRHSLSPEMQNKALEKAGLPYTYMAFEVDNTTFASAIEGLKALKMRGTGVSMPNKQLACEYVDELTP
AAKLVGAINTIVNDDGYLRGYNTDGTGHIRAIKESGFDMRGKTMVLLGAGGAATAIGAQAAIEGIKEIKLFNRKDDFFEK
AVAFAKRVNENTDCVVTVTDLADQHAFTEALASADILTNGTKVGMKPLENESLIGDVSLLRPELLVTECVYNPHMTKLLQ
QAQQAGCKTIDGYGMLLWQGAEQFELWTGKAFPLDYVKQVMGF
The query sequence (length=283) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1npd:B | 288 | 283 | 0.9117 | 0.8958 | 0.9117 | 0.0 | 1npd:A, 1o9b:A, 1o9b:B, 3t4e:A, 3t4e:B, 1vi2:A, 1vi2:B |
2 | 3toz:A | 291 | 281 | 0.5159 | 0.5017 | 0.5196 | 6.91e-111 | 3tnl:A, 3tnl:B, 3tnl:C, 3tnl:D, 3toz:B, 3toz:C, 3toz:D, 3toz:E, 3toz:F, 3toz:G, 3toz:H |
3 | 2hk9:A | 269 | 273 | 0.3322 | 0.3494 | 0.3443 | 2.07e-48 | 2hk9:B, 2hk9:C, 2hk9:D |
4 | 1nvt:A | 287 | 272 | 0.3675 | 0.3624 | 0.3824 | 5.43e-47 | 1nvt:B |
5 | 2ev9:B | 263 | 263 | 0.2792 | 0.3004 | 0.3004 | 2.47e-31 | 2cy0:A, 2d5c:A, 2d5c:B, 2ev9:A |
6 | 3doo:A | 258 | 269 | 0.2898 | 0.3178 | 0.3048 | 2.50e-31 | |
7 | 7col:A | 280 | 276 | 0.2968 | 0.3000 | 0.3043 | 4.89e-30 | 7col:B |
8 | 2o7q:A | 501 | 280 | 0.3145 | 0.1776 | 0.3179 | 4.33e-29 | 6bmb:A, 6bmq:A, 2gpt:A, 2o7s:A |
9 | 3pgj:A | 272 | 264 | 0.2968 | 0.3088 | 0.3182 | 1.65e-25 | 3pgj:B, 3pgj:C, 3pgj:D, 3sef:A, 3sef:B |
10 | 4k28:A | 266 | 266 | 0.2792 | 0.2970 | 0.2970 | 5.37e-21 | 4k28:B |
11 | 3sef:C | 244 | 257 | 0.2686 | 0.3115 | 0.2957 | 7.60e-21 | |
12 | 1nyt:A | 271 | 272 | 0.2650 | 0.2768 | 0.2757 | 4.80e-20 | 1nyt:B, 1nyt:C, 1nyt:D |
13 | 3jyo:A | 282 | 274 | 0.2792 | 0.2801 | 0.2883 | 1.94e-18 | 3jyp:A, 3jyq:A |
14 | 4p4g:A | 265 | 268 | 0.2933 | 0.3132 | 0.3097 | 1.22e-17 | 4p4l:A, 4p4l:B, 4p4l:C |
15 | 6hqv:A | 1555 | 279 | 0.2933 | 0.0534 | 0.2975 | 1.28e-17 | 6hqv:B |
16 | 4fos:A | 263 | 293 | 0.2686 | 0.2890 | 0.2594 | 4.17e-16 | 4fq8:A, 4fq8:B, 4fr5:A, 4fr5:B, 4fsh:A, 3phh:A, 3phi:A, 3phi:B, 3phj:A, 3phj:B |
17 | 7tbv:A | 682 | 292 | 0.2862 | 0.1188 | 0.2774 | 5.19e-16 | 7tbv:B, 7tbv:C, 7tbv:D |
18 | 1p77:A | 265 | 272 | 0.2509 | 0.2679 | 0.2610 | 8.91e-15 | |
19 | 5jox:A | 502 | 149 | 0.1272 | 0.0717 | 0.2416 | 0.15 | 5jox:B, 5joy:A, 5joy:B |
20 | 6tlk:A | 289 | 109 | 0.1237 | 0.1211 | 0.3211 | 0.18 | 1lua:A, 1lua:B, 1lua:C, 6tge:A, 6tge:C, 6tge:B, 6tge:D, 6tge:F, 6tge:E, 6tge:G, 6tge:I, 6tge:H, 6tge:J, 6tge:L, 6tge:K, 6tge:M, 6tge:O, 6tge:N, 6tge:P, 6tge:R, 6tge:Q, 6tge:S, 6tge:U, 6tge:T, 6tge:V, 6tge:X, 6tge:W, 6tlk:B, 6tlk:C, 6tlk:D, 6tlk:E, 6tlk:F, 6tm3:A |
21 | 5eqt:A | 249 | 56 | 0.0707 | 0.0803 | 0.3571 | 1.9 | |
22 | 1wql:A | 436 | 109 | 0.1095 | 0.0711 | 0.2844 | 2.0 | |
23 | 3oqo:A | 333 | 49 | 0.0601 | 0.0511 | 0.3469 | 3.8 | 3oqm:A, 3oqm:C, 3oqn:A, 3oqn:C, 3oqo:C |
24 | 3j9w:AL | 137 | 41 | 0.0459 | 0.0949 | 0.3171 | 3.8 | 8buu:l, 8cdu:L, 8cdv:L, 8cec:L, 8ced:L, 8cee:L, 6ha1:l, 6ha8:l, 6htq:l, 5njt:L, 7o5b:L, 8qcq:l, 7qgu:q, 7qh4:p, 8qpp:L, 7qv1:l, 7qv2:l, 7qv3:l, 8r55:L |
25 | 1i6u:A | 129 | 31 | 0.0389 | 0.0853 | 0.3548 | 7.3 | 1i6u:B |
26 | 4iw9:B | 215 | 57 | 0.0671 | 0.0884 | 0.3333 | 8.8 | 4iw9:A, 4iw9:C |
27 | 7d69:E | 99 | 51 | 0.0495 | 0.1414 | 0.2745 | 9.1 | 7d69:A |