TAEQLAQIAAENVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTRLTLVCSTAPGPLELDLTG
DLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLAR
GSYNIKSRFTDDDRTDHLSWEWNLTIKKEWKD
The query sequence (length=192) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1doa:B | 200 | 198 | 1.0000 | 0.9600 | 0.9697 | 1.85e-141 | 4f38:B, 5fr1:B, 5fr2:B, 1hh4:D, 1hh4:E |
2 | 5iai:A | 399 | 50 | 0.0729 | 0.0351 | 0.2800 | 2.5 | |
3 | 6vfs:A | 295 | 58 | 0.1042 | 0.0678 | 0.3448 | 2.7 | |
4 | 7ouc:AAA | 527 | 66 | 0.0938 | 0.0342 | 0.2727 | 3.3 | 7oud:AAA |
5 | 3rit:A | 354 | 25 | 0.0625 | 0.0339 | 0.4800 | 4.2 | 3rit:B, 3rit:C, 3rit:D, 3rit:E, 3ro6:B, 3ro6:A, 3ro6:C, 3ro6:D, 3ro6:E, 3ro6:F |