BioLiP

>protein
TAAERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFVKGDSVRACASLVVLSYPELKVVYEDSR
MVGLKAPYVSGFLAFREVPFLVELVQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKKLLQVDGL
ENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPLYVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRS
REYIRRTLGQ

The query sequence (length=250) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6ozj:B	250	250	1.0000	1.0000	1.0000	0.0	6ozj:A, 6ozk:A, 6ozk:B, 6ozl:A, 6ozl:B, 6ozm:A, 6ozm:B, 6ozn:A, 6ozn:B, 6ozo:A, 6ozo:B, 6ozp:A, 6ozp:B, 6ozq:A, 6ozq:B, 6ozr:A, 6ozr:B, 6ozs:A, 6ozs:B
2	6ozi:A	244	243	0.3880	0.3975	0.3992	8.68e-53	6ozh:A, 6ozh:C, 6ozh:B, 6ozh:D, 6ozi:B
3	3goc:A	228	206	0.3040	0.3333	0.3689	2.27e-24	3goc:B
4	6ozf:B	225	238	0.2840	0.3156	0.2983	5.10e-23	4b20:A, 4b20:B, 6ozf:A, 6ozg:A, 6ozg:B, 2w35:A, 2w35:B, 2w36:A, 2w36:B
5	2y7j:A	284	26	0.0440	0.0387	0.4231	2.1	2y7j:B, 2y7j:C, 2y7j:D
6	6qec:A	65	47	0.0720	0.2769	0.3830	3.6	5lxu:A
7	2d3t:C	390	81	0.0720	0.0462	0.2222	5.0	2d3t:D, 1wdk:C, 1wdk:D, 1wdl:C, 1wdl:D, 1wdm:C, 1wdm:D
8	7r50:A	473	42	0.0600	0.0317	0.3571	5.1	7r50:D, 7r50:E, 7r50:H, 7r50:I, 7r50:L, 7r50:M, 7r50:N, 7r50:P
9	2ebs:B	771	49	0.0720	0.0233	0.3673	6.3	2ebs:A
10	8di0:B	426	45	0.0600	0.0352	0.3333	7.2
11	8r9b:A	301	27	0.0520	0.0432	0.4815	7.5	7b5o:J, 7b5q:J, 8orm:J, 8p4z:A, 8p4z:B, 8p6v:J, 8p6w:J, 8p6x:J, 8p6y:J, 8p6z:J, 8p70:J, 8p71:J, 8p72:J, 8p73:J, 8p74:J, 8p75:J, 8p76:J, 8p77:J, 8p78:J, 8p7l:J, 8plz:J, 8r99:A, 8r9a:A, 8r9b:B, 8r9b:C, 8r9b:D, 8r9o:A, 8r9o:B, 8r9s:A, 8r9s:B, 8r9u:A, 8r9u:B, 1ua2:A, 1ua2:B, 1ua2:C, 1ua2:D, 6xbz:J, 6xd3:J

[Back]