SYVREFIGEFLGTFVLMFLGEGATANFHTTGLSGDWYKLCLGWGLAVFFGILVSAKLSGAHLNLAVSIGLSSINKFDLKK
IPVYFFAQLLGAFVGTSTVYGLYHGFISNSKIPQFAWETSRNPSISLTGAFFNELILTGILLLVILVVVDENICGKFHIL
KLSSVVGLIILCIGITFGGNTGFALNPSRDLGSRFLSLIAYGKDTFTKDNFYFWVPLVAPCVGSVVFCQFYDKVICPLVD
LA
The query sequence (length=242) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3c02:A | 242 | 242 | 1.0000 | 1.0000 | 1.0000 | 2.45e-175 | |
2 | 6f7h:C | 253 | 245 | 0.3595 | 0.3439 | 0.3551 | 4.73e-43 | 6f7h:A, 6f7h:B |
3 | 8c9h:A | 253 | 233 | 0.3223 | 0.3083 | 0.3348 | 2.63e-39 | 8c9h:B, 8c9h:C, 8c9h:D, 8c9h:E, 8c9h:F, 8c9h:G, 8c9h:H, 6n1g:A, 6n1g:C, 6n1g:B, 6n1g:D, 6qzi:A, 6qzj:A |
4 | 1fx8:A | 254 | 248 | 0.3802 | 0.3622 | 0.3710 | 9.74e-36 | |
5 | 8jy6:A | 242 | 236 | 0.3223 | 0.3223 | 0.3305 | 4.87e-30 | 8jy6:B, 8jy6:C, 8jy6:D, 8jy8:A, 8jy8:B, 8jy8:C, 8jy8:D |
6 | 2evu:A | 245 | 261 | 0.3140 | 0.3102 | 0.2912 | 5.22e-20 | 2f2b:A |
7 | 8sjx:A | 220 | 238 | 0.2686 | 0.2955 | 0.2731 | 2.01e-11 | 8sjy:A |
8 | 5dye:D | 253 | 242 | 0.2727 | 0.2609 | 0.2727 | 8.46e-09 | 5c5x:A, 5c5x:B, 5c5x:C, 5c5x:D, 5c5x:E, 5c5x:H, 3d9s:C, 3d9s:D, 5dye:A, 5dye:B, 5dye:C |
9 | 8ct2:D | 247 | 249 | 0.2562 | 0.2510 | 0.2490 | 2.61e-08 | 8ct2:B, 8ct2:C, 8ct2:A, 8cte:O, 8cte:S, 8cte:R, 8cte:M, 7uze:D, 7uze:B, 7uze:C, 7uze:A |
10 | 4nef:A | 239 | 243 | 0.2645 | 0.2678 | 0.2634 | 2.90e-08 | |
11 | 8uy6:A | 244 | 195 | 0.2273 | 0.2254 | 0.2821 | 1.98e-07 | 3nka:A, 2o9e:A, 8uy6:C, 8uy6:E, 8uy6:G, 8uy6:I, 8uy6:K, 8uy6:M, 8uy6:O |
12 | 5bn2:A | 260 | 225 | 0.2397 | 0.2231 | 0.2578 | 0.007 | |
13 | 4mz0:B | 823 | 92 | 0.1198 | 0.0352 | 0.3152 | 0.72 | |
14 | 4mz0:A | 896 | 92 | 0.1198 | 0.0324 | 0.3152 | 0.73 | |
15 | 6iit:B | 100 | 87 | 0.1074 | 0.2600 | 0.2989 | 1.5 | 6iiq:A, 6iiq:B, 6iir:A, 6iir:B, 6iis:B, 6iis:A, 6iit:A |
16 | 8ciw:A | 555 | 46 | 0.0661 | 0.0288 | 0.3478 | 3.4 | 8ciw:B |
17 | 1orf:A | 232 | 52 | 0.0496 | 0.0517 | 0.2308 | 5.1 | |
18 | 6ao8:A | 569 | 79 | 0.1074 | 0.0457 | 0.3291 | 5.5 | |
19 | 5ayk:A | 744 | 35 | 0.0702 | 0.0228 | 0.4857 | 7.6 | 5ayl:A |