Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
SYTEADPAILSRRQKQIDYGKNTAAYERYVEMVPKDEHPRTPNKYGKYSRRAFDGLVKIWRKSLHIY

The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 4tuw:A 71 68 0.9403 0.8873 0.9265 3.09e-41 4tuw:B, 4tux:B, 4tux:A
2 4tv0:A 47 62 0.6716 0.9574 0.7258 3.38e-25
3 4qoz:C 73 69 0.5373 0.4932 0.5217 5.61e-22 4l8r:C
4 6j9f:D 1215 40 0.2090 0.0115 0.3500 0.17 6j9e:D
5 3t8q:B 369 55 0.2537 0.0461 0.3091 1.2 3t8q:A
6 7bvc:A 1078 51 0.2388 0.0148 0.3137 1.3 7bvg:A
7 6iqy:A 536 29 0.1642 0.0205 0.3793 2.0 3abg:A, 3abg:B, 6i3j:A, 6i3j:B, 6i3k:A, 6i3k:B, 6i3l:A, 6i3l:B, 6iqx:A, 6iqx:B, 6iqy:B, 6iqz:A, 2xll:A, 2xll:B, 2xll:C, 2xll:D
8 5u7w:A 404 29 0.1642 0.0272 0.3793 2.7 5u7v:A
9 4krh:A 430 20 0.1343 0.0209 0.4500 3.5 4krh:B, 4kri:A, 4kri:B, 4kri:C
10 1lpc:A 254 31 0.1343 0.0354 0.2903 4.2 1lpd:A
11 2yik:A 493 36 0.1940 0.0264 0.3611 4.9
12 5u7x:F 412 30 0.1791 0.0291 0.4000 7.9

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218