BioLiP

>protein
SYRVSTGAAHAAKGGGLVSGDSYSMMELGARKYAAAISDGRAHFESNETIKLLEKILESGIDEKIAIKTINSILSLRTTD
EIYSTLDLSIIDLQDASCKFLKVGSTPSFIKRGDQVMKVQASNLPIGIINEFDVEVVSEQLKAGDLLIMMSDGIFENHDL
WMKRKMKGLKTNDPQEIADLLMEEVIRTRSGQIEDDMTVVVVRIDHNTPKWASIPVPAI

The query sequence (length=219) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3t9q:B	227	226	1.0000	0.9648	0.9690	8.84e-158	3t91:A, 3t91:B, 3t9q:A
2	3pu9:A	236	199	0.2237	0.2076	0.2462	1.03e-07	3pu9:B
3	8k7p:A	382	68	0.1142	0.0654	0.3676	0.062	8k7p:B, 8k7q:A, 8k7q:B, 6ksi:A, 6ksi:B, 6ksl:A, 6ksl:B, 6ksm:A, 6ksm:B, 8s9r:A, 8s9r:B, 8yib:A, 8yib:B
4	7qix:R	150	27	0.0639	0.0933	0.5185	1.7	8auv:W, 8b2l:W1, 7qiz:HA
5	3in1:A	312	21	0.0548	0.0385	0.5714	5.9	3in1:B
6	7oik:A	4426	66	0.1005	0.0050	0.3333	5.9	7oim:A, 6tax:A, 6tay:A
7	4wy0:B	260	61	0.0959	0.0808	0.3443	6.7	4wy0:D, 4wy0:E, 4wy0:G, 4wy0:I, 4wy0:J, 4wy0:K, 1znn:A, 1znn:B, 1znn:C, 1znn:D, 1znn:E, 1znn:F
8	7k1r:A	536	24	0.0502	0.0205	0.4583	6.7	7k1r:B, 7k1r:C, 7k1r:D, 8uws:C, 8uws:D, 8uws:A, 8uws:B
9	5ffc:A	148	69	0.0731	0.1081	0.2319	7.2	5fej:A, 5fej:B, 5fej:C, 5fej:D, 5ffd:A, 5ffe:A, 5ffe:B
10	6yjn:A	212	27	0.0502	0.0519	0.4074	8.5	6yl7:A

[Back]