SYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYMSWS
The query sequence (length=51) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8gy7:P | 51 | 51 | 1.0000 | 1.0000 | 1.0000 | 4.74e-30 | |
2 | 7kgg:C | 1020 | 24 | 0.2157 | 0.0108 | 0.4583 | 1.9 | 7kgh:C, 7kgi:A, 7kgi:C |
3 | 3ik7:A | 221 | 34 | 0.2353 | 0.0543 | 0.3529 | 7.5 | 1gul:A, 1gul:B, 1gul:C, 1gul:D, 1gul:E, 1gul:F, 1gul:G, 1gul:H, 3ik7:B, 3ik7:C, 3ik7:D |
4 | 5glt:A | 278 | 39 | 0.2157 | 0.0396 | 0.2821 | 8.4 | 5glt:B, 5glu:A, 5glu:B, 5glw:A, 5glz:A, 5glz:B, 5glz:C, 5gm0:A, 5gm0:B |
5 | 3c3d:A | 306 | 15 | 0.1569 | 0.0261 | 0.5333 | 9.0 | 3c3d:B, 3c3d:C, 3c3d:D, 3c3e:A, 3c3e:B, 3c3e:C, 3c3e:D |