>protein
SYDQAFLEQYEKIKDPASGYFREFNGLLVPYHSVETMIVEAPDHGHQTTSEAFSYYLWLEAYYGRVTGDWKPLHDAWESM
ETFIIPGTKDQPTNSAYNPNSPATYIPEQPNADGYPSPLMNNVPVGQDPLAQELSSTYGTNEIYGMHWLLDVDNVYGFGF
CGDGTDDAPAYINTYQRGARESVWETIPHPSCDDFTHGGPNGYLDLFTDDQNYAKQWRYTNAPNADARAVQVMFWAHEWA
KEQGKENEIAGLMDKASKMGDYLRYAMFDKYFKKIGNCVGATSCPGGQGKDSAHYLLSWYYSWGGSLDSAWAWRIGSSSS
HQGYQNVLAAYALSQVPELQPDSPTGVQDWATSFDRQLEFLQWLQSAEGGIAGGATNSWKGSYDTPPTGLSQFYGMYYDW
QPVWNDPPSNNWFGFQVWNMERVAQLYYVTGDARAEAILDKWVPWAIQHTDVDADNGGQNFQVPSDLEWSGQPDTWTGTY
TGNPNLHVQVVSYSQDVGVTAALAKTLMYYAKRSGDTTALATAEGLLDALLAHRDSIGIATPEQPSWDRLDDPWDGSEGL
YVPPGWSGTMPNGDRIEPGATFLSIRSFYKNDPLWPQVEAHLNDPQNVPAPIVERHRFWAQVEIATAFAAHDELFG

The query sequence (length=636) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4jjj:A	636	636	1.0000	1.0000	1.0000	0.0
2	6d5d:A	627	641	0.5755	0.5837	0.5710	0.0	4el8:A, 4l0g:A, 4txt:A
3	4fus:A	635	648	0.5440	0.5449	0.5340	0.0
4	1f9d:A	629	641	0.5487	0.5548	0.5445	0.0	1f9o:A, 1fae:A, 1fbo:A, 1fbw:A, 1fce:A, 1g9g:A, 1g9j:A, 2qno:A
5	4xwl:A	634	648	0.5252	0.5268	0.5154	0.0	4xwm:A, 4xwn:A
6	1l1y:A	642	646	0.5267	0.5218	0.5186	0.0	1l1y:B, 1l1y:C, 1l1y:D, 1l1y:E, 1l1y:F, 1l2a:A, 1l2a:B, 1l2a:C, 1l2a:D, 1l2a:E, 1l2a:F, 5yj6:A
7	7kw6:A	697	706	0.5189	0.4735	0.4674	0.0
8	5bv9:A	701	716	0.5126	0.4650	0.4553	0.0	5cvy:A, 5vma:A
9	4w66:A	236	90	0.0346	0.0932	0.2444	0.70	4w66:B
10	1fch:A	302	43	0.0236	0.0497	0.3488	1.2	1fch:B, 9gag:A
11	8any:6	354	85	0.0393	0.0706	0.2941	1.5	6i9r:6, 8k2a:Ll, 8k2b:Ll, 7l08:6, 7l20:6, 7odr:6, 7ods:6, 7odt:6, 7og4:6, 8oir:Bn, 8oit:Bn, 8pk0:6, 7po4:6, 7qi4:6, 7qi5:6, 7qi6:6, 8qsj:6, 8qu1:6, 6vlz:6, 6vmi:6, 8xt0:Ll, 8xt1:Ll, 8xt2:Ll, 8xt3:Ll, 6zm5:6, 6zm6:6, 6zs9:6, 6zsa:6, 6zsb:6, 6zsc:6, 6zsd:6, 6zse:6, 6zsg:6
12	2z7b:A	237	49	0.0220	0.0591	0.2857	3.0
13	1lws:A	427	30	0.0173	0.0258	0.3667	3.1	1ef0:A, 1um2:A, 1um2:B
14	7o9k:6	331	85	0.0377	0.0725	0.2824	3.2	7a5f:63, 7a5g:63, 7a5h:6, 7a5i:63, 7a5j:6, 7a5k:63, 3j7y:6, 3j9m:6, 6nu2:6, 6nu3:6, 7o9m:6, 7of0:6, 7of2:6, 7of3:6, 7of4:6, 7of5:6, 7of6:6, 7of7:6, 7oi6:6, 7oi7:6, 7oi8:6, 7oi9:6, 7oia:6, 7oib:6, 7oic:6, 7oid:6, 7oie:6, 5ool:6, 5oom:6, 7pd3:6, 7qh6:6, 8qu5:6
15	1lwt:A	448	30	0.0173	0.0246	0.3667	3.7
16	7qh7:6	292	85	0.0377	0.0822	0.2824	4.0

[Back]