BioLiP

>protein
SWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTILLQDKQRKIYCVACQEL

The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6hcz:A	65	65	1.0000	1.0000	1.0000	1.68e-43	6hcz:B
2	4qiw:B	1069	24	0.1846	0.0112	0.5000	0.065	4qiw:J
3	8oki:B	1101	25	0.1846	0.0109	0.4800	0.068	8cro:B, 8orq:B, 8p2i:B, 8rbo:B
4	6kf3:B	1114	24	0.1846	0.0108	0.5000	0.072	9bct:B, 9bcu:B, 6kf4:B, 6kf9:B
5	3qqc:A	381	24	0.1846	0.0315	0.5000	0.081
6	3qqc:A	381	24	0.1692	0.0289	0.4583	1.2
7	2ebq:A	47	20	0.1692	0.2340	0.5500	0.31	2gqe:A, 2k0c:A
8	7mo2:B	38	20	0.1538	0.2632	0.5000	0.32	3ch5:B, 7mo2:D
9	7elh:B	1264	35	0.1846	0.0095	0.3429	1.9	1mwh:A, 1n1h:A, 1n35:A, 1n38:A, 1uon:A, 7yed:R, 7yfe:R
10	7plo:K	639	34	0.2000	0.0203	0.3824	2.7	8b9d:K, 7pfo:K
11	4die:C	213	41	0.2154	0.0657	0.3415	2.8	4die:A, 4die:B, 4die:D
12	7kyd:A	534	23	0.1538	0.0187	0.4348	2.9
13	8oki:A	901	24	0.1692	0.0122	0.4583	3.9	8cro:A, 8orq:A, 8p2i:A, 8rbo:A
14	6ysf:E	252	29	0.1846	0.0476	0.4138	5.1	6ysf:D
15	3nd1:B	249	30	0.1846	0.0482	0.4000	5.8	3nd1:A
16	7ezt:B	727	34	0.1538	0.0138	0.2941	7.1
17	4iwh:A	358	40	0.2154	0.0391	0.3500	7.2	4iwh:B, 4xxv:A, 4xxv:B
18	1pn4:D	273	11	0.1231	0.0293	0.7273	8.2	1pn4:A, 1pn4:B
19	5zy9:C	400	25	0.1692	0.0275	0.4400	8.6	5zy9:D, 5zy9:E
20	3tkn:A	451	46	0.1538	0.0222	0.2174	8.7	3pbp:A, 3pbp:D, 3pbp:G, 3pbp:J, 3tkn:G, 3tkn:D
21	7mo1:B	34	19	0.1538	0.2941	0.5263	10.0

[Back]