SWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDL
IDCLSQKQFKEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMK
The query sequence (length=143) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8alz:A | 258 | 143 | 0.9930 | 0.5504 | 0.9930 | 2.69e-103 | 8yey:C, 8yey:A, 8yfi:A, 8yfj:A, 8yxw:A, 8yxw:C, 8yxx:A, 8yxx:C |
2 | 8t8s:B | 664 | 51 | 0.1119 | 0.0241 | 0.3137 | 2.3 | 3f6k:A, 5mrh:A, 5mri:A, 4msl:A, 4n7e:A, 5nmr:A, 4po7:A, 8t8r:A, 8t8s:A, 6x3l:A, 6x48:A, 6x4h:A |
3 | 1g8x:A | 1009 | 23 | 0.0909 | 0.0129 | 0.5652 | 3.2 | 1g8x:B |
4 | 4af3:A | 253 | 61 | 0.1399 | 0.0791 | 0.3279 | 3.3 | |
5 | 6gr8:A | 272 | 61 | 0.1538 | 0.0809 | 0.3607 | 4.5 | 6gr9:A |
6 | 1dgj:A | 906 | 41 | 0.0979 | 0.0155 | 0.3415 | 4.7 | |
7 | 5i4e:A | 959 | 41 | 0.1259 | 0.0188 | 0.4390 | 8.7 |