SWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDL
IDCLSQKQFKEQFPDISQESDSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLM
The query sequence (length=142) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8alz:A | 258 | 142 | 0.9930 | 0.5465 | 0.9930 | 1.16e-102 | 8yey:C, 8yey:A, 8yfi:A, 8yfj:A, 8yxw:A, 8yxw:C, 8yxx:A, 8yxx:C |
2 | 8t8s:B | 664 | 51 | 0.1127 | 0.0241 | 0.3137 | 2.3 | 3f6k:A, 5mrh:A, 5mri:A, 4msl:A, 4n7e:A, 5nmr:A, 4po7:A, 8t8r:A, 8t8s:A, 6x3l:A, 6x48:A, 6x4h:A |
3 | 1g8x:A | 1009 | 23 | 0.0915 | 0.0129 | 0.5652 | 3.0 | 1g8x:B |
4 | 4af3:A | 253 | 61 | 0.1408 | 0.0791 | 0.3279 | 3.3 | |
5 | 1dgj:A | 906 | 41 | 0.0986 | 0.0155 | 0.3415 | 4.7 | |
6 | 6gr8:A | 272 | 61 | 0.1549 | 0.0809 | 0.3607 | 4.7 | 6gr9:A |
7 | 5i4e:A | 959 | 41 | 0.1268 | 0.0188 | 0.4390 | 8.5 |