SVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKA
DFQGISPERAFADFLFASTILHLVVMNFVG
The query sequence (length=110) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8pn9:D | 110 | 110 | 1.0000 | 1.0000 | 1.0000 | 4.85e-76 | 6s7o:D, 6s7t:D |
2 | 8agb:D | 110 | 92 | 0.3727 | 0.3727 | 0.4457 | 3.14e-20 | 8agc:D, 6ezn:B, 7oci:B |
3 | 6vs4:A | 223 | 21 | 0.0909 | 0.0448 | 0.4762 | 2.1 | 6vs4:B |
4 | 5k7x:A | 337 | 42 | 0.1455 | 0.0475 | 0.3810 | 5.8 | 5k7x:B, 5k7x:C, 5k7x:D, 5k7x:E, 5k7x:F |
5 | 8sq0:A | 1402 | 28 | 0.1182 | 0.0093 | 0.4643 | 8.1 | 8sq0:B, 8sql:A, 8sqm:A |