BioLiP

>protein
SVQKFPGDANCDGIVDISDAVLIMQTMANPSKYQMTDKGRINADVTGNSDGVTVLDAQFIQSYCLGLVELPPVE

The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5m2o:B	74	74	1.0000	1.0000	1.0000	1.53e-50
2	5m2s:B	79	72	0.5000	0.4684	0.5139	2.20e-19
3	5n5p:B	87	38	0.2568	0.2184	0.5000	2.26e-08	5n5p:D
4	4uyp:B	73	68	0.3243	0.3288	0.3529	6.52e-04	4uyp:D, 4uyq:B
5	4dh2:B	72	66	0.2568	0.2639	0.2879	0.021	4dh2:D
6	2y3n:B	60	42	0.1757	0.2167	0.3095	0.045
7	4fl4:A	68	68	0.2838	0.3088	0.3088	0.051	4fl4:D, 4fl4:G, 4fl4:J
8	3ul4:B	63	68	0.3108	0.3651	0.3382	0.22
9	5lxv:B	65	70	0.2703	0.3077	0.2857	0.38	5lxv:D
10	7u3d:C	677	40	0.1622	0.0177	0.3000	0.57
11	7u3b:C	696	40	0.1622	0.0172	0.3000	0.57	7u3a:A, 7u3a:B, 7u3a:C, 7u3a:D, 7u3b:H, 7u3b:D, 7u3b:F, 7u3b:E, 7u3b:I, 7u3b:G, 7u3b:J, 7u3d:B, 7u3d:F, 7u3d:A
12	8x3a:A	151	67	0.2838	0.1391	0.3134	0.79	8x39:A, 8x39:B
13	1daq:A	71	72	0.3108	0.3239	0.3194	0.97	1dav:A, 2mte:A
14	2y3n:D	49	25	0.1081	0.1633	0.3200	1.8
15	2ccl:B	62	64	0.2027	0.2419	0.2344	2.4	2ccl:D, 1ohz:B
16	7k3p:A	329	26	0.1216	0.0274	0.3462	4.6	7k3p:B
17	8j1j:B	387	38	0.1351	0.0258	0.2632	6.8	8j12:B, 8j3r:B
18	8j12:A	424	38	0.1351	0.0236	0.2632	6.8	8dzj:A, 8dzj:B, 8j1j:A, 8j3r:A, 7wju:A, 7wju:B
19	7clt:A	102	26	0.1081	0.0784	0.3077	7.8	7ygv:A, 7ygw:A

[Back]