BioLiP

>protein
SVPTKLEVVAATPTSLLISWDAPAVTVFFYVITYGETGHGVGAFQAFKVPGSKSTATISGLKPGVDYTITVYARGYSKQG
PYKPSPISINYRT

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7l0f:H	94	93	0.9677	0.9574	0.9677	1.02e-61	7l0f:F, 7l0f:B, 7l0f:M, 7l0g:C, 7l0g:D, 7l0g:F, 7l0g:H
2	5mtm:B	92	93	0.7957	0.8043	0.7957	8.18e-44
3	5v7p:D	95	93	0.8172	0.8000	0.8172	2.90e-42
4	8f0m:B	91	98	0.7957	0.8132	0.7551	2.85e-39
5	5a43:C	96	94	0.7742	0.7500	0.7660	4.53e-38
6	4lxo:A	184	93	0.7419	0.3750	0.7419	5.62e-38	4lxo:B
7	4lxo:A	184	79	0.2366	0.1196	0.2785	1.41e-05	4lxo:B
8	6d0j:C	90	93	0.7097	0.7333	0.7097	4.83e-35	6d0k:C, 6d0n:C
9	6ux8:B	86	92	0.6989	0.7558	0.7065	2.97e-34
10	3ch8:A	190	93	0.7312	0.3579	0.7312	3.50e-32	2qbw:A
11	8vxu:E	90	95	0.7312	0.7556	0.7158	1.23e-30	7szt:F, 8tgy:C, 8tgy:D, 6wk9:C, 6wk9:G
12	4jmh:A	200	93	0.6667	0.3100	0.6667	1.31e-29	4jmg:A
13	3csb:A	464	95	0.7312	0.1466	0.7158	4.85e-28
14	6gvk:A	201	95	0.3441	0.1592	0.3368	3.11e-05	6gvl:A
15	6gvk:A	201	92	0.2473	0.1144	0.2500	0.11	6gvl:A
16	2mnu:A	93	69	0.2688	0.2688	0.3623	2.64e-04
17	6x39:A	100	77	0.2903	0.2700	0.3506	0.11
18	6tba:7A	292	37	0.1398	0.0445	0.3514	1.4	6tba:7C, 6tba:7B, 6teh:C
19	4ine:A	431	20	0.1075	0.0232	0.5000	4.1	4ine:B
20	1e3d:B	537	50	0.1720	0.0298	0.3200	5.0	1e3d:D
21	1unb:A	288	33	0.1183	0.0382	0.3333	6.0	1e5h:A, 1hjf:A, 2jb8:A, 1rxg:A, 1uo9:A, 1uob:A, 1w2a:X, 1w2n:A, 1w2o:A
22	2zoo:A	438	29	0.1398	0.0297	0.4483	6.3
23	6bt9:B	626	69	0.2151	0.0319	0.2899	6.5	6bt9:A
24	3ddv:B	139	41	0.1398	0.0935	0.3171	8.7	3ddv:D
25	6hiv:DA	1557	14	0.0860	0.0051	0.5714	9.2	6hiw:DA, 7pub:DA

[Back]