SVPRARLLQLVKARCELFSTTFNPEGIRTGNKILRQRLKGPALATYYPRKNVGIRELQKEFGTLGLEVDDEVDDDRLEHL
AALRARDKGAPKKKRTAPS
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6yw5:YY | 99 | 99 | 1.0000 | 1.0000 | 1.0000 | 8.70e-69 | 6ywe:YY, 6ywx:YY, 6ywy:YY |
2 | 8om2:X | 98 | 96 | 0.4040 | 0.4082 | 0.4167 | 2.98e-18 | 8d8k:X, 8d8l:X, 5mrc:XX, 5mre:XX, 5mrf:XX, 8om3:X, 8om4:X |
3 | 6xyw:Bx | 79 | 85 | 0.2929 | 0.3671 | 0.3412 | 1.83e-07 | |
4 | 3sf6:A | 387 | 40 | 0.1515 | 0.0388 | 0.3750 | 2.6 | |
5 | 6n6q:B | 448 | 47 | 0.1313 | 0.0290 | 0.2766 | 3.1 | 6n6q:A, 6n6q:C, 6n6q:D |
6 | 2hcf:A | 225 | 63 | 0.2121 | 0.0933 | 0.3333 | 3.1 | |
7 | 4ywe:A | 476 | 20 | 0.1111 | 0.0231 | 0.5500 | 5.7 | 4ywe:B, 4ywe:C, 4ywe:D, 4ywe:E, 4ywe:F, 4ywe:G, 4ywe:H |
8 | 6iv9:A | 874 | 24 | 0.0909 | 0.0103 | 0.3750 | 9.0 | 6iv8:A, 6iv8:C |