SVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNKYCPRQYSLLEKRSS
LYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVPEVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLY
RFGKVKMLLWMPSTTARKLLARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGKP
IALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLKKCPIDLTNDEFIYLTKLFMEW
PFKPDILMDFVDMYQTEHSG
The query sequence (length=340) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8att:B | 340 | 340 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8ap1:B, 8atv:B, 8atw:B, 8c5s:B, 8c5u:B, 8q63:B, 6ymv:B, 6ymw:B |
2 | 8csp:5 | 319 | 71 | 0.0559 | 0.0596 | 0.2676 | 0.011 | 6aax:A, 6aax:C, 6ajk:A, 8csq:5, 8csr:5, 8csu:5 |
3 | 4gc9:A | 318 | 69 | 0.0529 | 0.0566 | 0.2609 | 0.041 | 7pnt:c |
4 | 6rm3:LA0 | 232 | 48 | 0.0471 | 0.0690 | 0.3333 | 0.16 | |
5 | 1g6h:A | 254 | 85 | 0.0647 | 0.0866 | 0.2588 | 2.2 | 1g9x:A, 1g9x:B, 1g9x:C |
6 | 7dsn:A | 471 | 80 | 0.0471 | 0.0340 | 0.2000 | 2.4 | 2dh3:A, 6jmq:B |
7 | 3dtn:A | 220 | 82 | 0.0647 | 0.1000 | 0.2683 | 7.7 | 3dtn:B |
8 | 5m99:A | 506 | 31 | 0.0324 | 0.0217 | 0.3548 | 9.8 | 5m99:B |