SVLSIVTVPDKRLSLCSEEVEKVDQSIRKLVDDMFETMHANQGLGLAAVQVGVHKRILVMNVPEENVEDKIEGYELYGGP
YCIINPKIVDISQEKVKLKEGCLSVPGYFDYIVRPQRIAVQYLDYNGNECIIKAQGWLARCLQHEIDHLNGTVFLKYLSK
FKRDFAIEKVKKKERTDLI
The query sequence (length=179) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3oca:A | 179 | 179 | 1.0000 | 1.0000 | 1.0000 | 3.77e-132 | 3oca:B, 3u04:A |
2 | 1ix1:A | 169 | 175 | 0.4302 | 0.4556 | 0.4400 | 1.13e-49 | 1ix1:B, 1lry:A, 1n5n:A, 1n5n:B, 1s17:A, 1s17:B |
3 | 6jex:A | 172 | 172 | 0.4134 | 0.4302 | 0.4302 | 2.96e-45 | 6jer:A, 6jer:B, 6jet:A, 6jet:B, 6jeu:A, 6jeu:B, 6jev:A, 6jev:B, 6jew:A, 6jew:B, 6jex:B |
4 | 5j46:A | 169 | 176 | 0.4413 | 0.4675 | 0.4489 | 6.02e-44 | |
5 | 3fwx:A | 165 | 174 | 0.4078 | 0.4424 | 0.4195 | 1.22e-41 | 3fwx:B |
6 | 1bs4:A | 168 | 175 | 0.3911 | 0.4167 | 0.4000 | 6.15e-41 | 2ai8:A, 2ai8:B, 2ai8:C, 4al2:B, 4al3:A, 4az4:A, 1bs4:B, 1bs4:C, 1bs5:A, 1bs5:B, 1bs5:C, 1bs6:A, 1bs6:B, 1bs6:C, 1bs8:A, 1bs8:B, 1bs8:C, 1bsj:A, 1bsk:A, 1bsz:A, 1bsz:B, 1bsz:C, 7d6z:g, 1def:A, 2def:A, 1dff:A, 1g27:A, 1g27:B, 1g27:C, 1g2a:A, 1g2a:B, 1g2a:C, 3k6l:A, 3k6l:B, 2kmn:A, 1lru:A, 1lru:B, 1lru:C, 8ofe:A, 8rhr:A, 2w3t:A, 2w3u:A, 1xem:A, 1xen:A, 1xeo:A |
7 | 6ck7:A | 172 | 175 | 0.4134 | 0.4302 | 0.4229 | 1.98e-40 | 6ck7:B, 6ck7:C, 6ck7:D |
8 | 4wxl:C | 165 | 172 | 0.3911 | 0.4242 | 0.4070 | 1.99e-39 | 4wxl:A, 4wxl:B, 4wxl:D |
9 | 3qu1:A | 168 | 173 | 0.3799 | 0.4048 | 0.3931 | 4.39e-35 | 3qu1:B |
10 | 2ew5:A | 166 | 164 | 0.3631 | 0.3916 | 0.3963 | 7.52e-35 | 4e9a:A, 4e9b:A, 2ew6:A, 2ew7:A |
11 | 4dr8:A | 188 | 170 | 0.3296 | 0.3138 | 0.3471 | 2.09e-31 | 4dr8:B, 4dr8:C, 4dr8:D, 4dr9:A, 4dr9:B, 4dr9:C, 4dr9:D |
12 | 3uwb:A | 149 | 157 | 0.3575 | 0.4295 | 0.4076 | 3.01e-30 | 3uwa:A |
13 | 3cpm:A | 184 | 159 | 0.3073 | 0.2989 | 0.3459 | 1.16e-27 | 3m6o:A, 3m6o:B, 3m6p:A, 3m6p:B, 3m6q:A, 3m6r:A, 3m6r:B, 3m6r:C, 3m6r:D, 3o3j:A, 3pn2:A, 3pn3:A, 3pn3:B, 3pn4:A, 3pn5:A, 3pn6:A, 3pn6:B |
14 | 1jym:A | 179 | 158 | 0.3296 | 0.3296 | 0.3734 | 1.84e-25 | 1jym:B, 1jym:C, 1jym:D, 1jym:E, 1jym:F, 1jym:G, 1jym:H, 1jym:I, 1jym:J, 1rl4:A, 1rl4:B, 1rqc:A, 1rqc:B, 1rqc:C, 1rqc:D, 1rqc:E, 1rqc:F, 1rqc:G, 1rqc:H, 1rqc:I, 1rqc:J |
15 | 6jfc:B | 161 | 162 | 0.3073 | 0.3416 | 0.3395 | 8.35e-25 | 6jfa:A, 6jfc:A, 6jfd:C, 6jfe:B, 6jff:B, 6jfn:B |
16 | 1y6h:A | 177 | 170 | 0.3408 | 0.3446 | 0.3588 | 1.14e-24 | 1sv2:A, 1sv2:B, 1szz:A, 1szz:B, 1szz:C, 1szz:D, 1szz:E, 1szz:F, 1szz:G, 1szz:H, 1vev:A, 1vev:B, 1vey:A, 1vey:B, 1vez:A, 1vez:B, 1y6h:B |
17 | 1ws1:A | 151 | 161 | 0.3128 | 0.3709 | 0.3478 | 4.92e-24 | |
18 | 5kob:A | 171 | 164 | 0.3128 | 0.3275 | 0.3415 | 2.08e-21 | 5kob:B, 5kob:C, 5kob:D, 5vcp:A, 5vcp:B, 5vcp:C, 5vcp:D |
19 | 2os3:A | 205 | 152 | 0.3520 | 0.3073 | 0.4145 | 6.06e-21 | |
20 | 3g5k:A | 183 | 163 | 0.2682 | 0.2623 | 0.2945 | 1.41e-20 | 3g5k:B, 3g5k:C, 3g5k:D, 3g5p:A, 3g5p:B, 3g5p:C, 3g5p:D |
21 | 5mtc:A | 137 | 130 | 0.2849 | 0.3723 | 0.3923 | 2.84e-20 | 5mtc:B, 5mtd:A, 5mtd:B, 5mte:A, 5mte:B |
22 | 6jes:A | 159 | 132 | 0.2737 | 0.3082 | 0.3712 | 3.20e-20 | 6jes:B, 6jf3:A, 6jf3:B, 6jf4:B, 6jf4:A, 6jf5:B, 6jf5:A, 6jf6:C, 6jf6:A, 6jf6:B, 6jf6:D, 6jf7:A, 6jf7:B, 6jf8:A, 6jf8:B, 6jf8:C, 6jf8:D |
23 | 2okl:A | 185 | 149 | 0.3017 | 0.2919 | 0.3624 | 6.38e-19 | 2okl:B |
24 | 6ow7:P | 196 | 141 | 0.3184 | 0.2908 | 0.4043 | 6.91e-19 | 2ai7:A, 2aia:A, 2aie:P, 4eox:P, 1lm6:A, 6ow2:P, 6ow7:Q, 3str:P, 3svj:P, 3sw8:P |
25 | 5cy7:A | 171 | 158 | 0.2849 | 0.2982 | 0.3228 | 2.34e-18 | 5cp0:A, 5cpd:A, 5cvk:A, 5cvp:A, 5cvq:A, 5cwx:A, 5cwy:A, 5cx0:A, 5cxj:A, 5cy8:A, 6ikt:A, 6iky:A, 6il0:A, 6il2:A, 4nt8:A |
26 | 5jex:A | 203 | 145 | 0.3017 | 0.2660 | 0.3724 | 4.54e-18 | 5jez:A, 5jf0:A, 5jf1:A, 5jf2:A, 5jf3:A, 5jf4:A, 5jf5:A, 5jf6:A, 5jf7:A, 5jf8:A |
27 | 4je6:A | 193 | 136 | 0.2514 | 0.2332 | 0.3309 | 1.61e-17 | 4je6:B, 4je7:A, 4je7:B, 4je8:A, 4je8:B, 1zxz:A, 1zxz:B, 1zy0:A, 1zy0:B, 1zy1:A, 1zy1:B |
28 | 3l87:A | 200 | 137 | 0.2682 | 0.2400 | 0.3504 | 3.56e-17 | |
29 | 1lqy:A | 184 | 149 | 0.3073 | 0.2989 | 0.3691 | 4.81e-17 | |
30 | 1lm4:A | 190 | 121 | 0.2402 | 0.2263 | 0.3554 | 1.29e-16 | 6jfg:A, 6jfo:A, 6jfq:A, 6jfr:A, 6jfs:A, 1lm4:B, 1lmh:A, 1lqw:A, 1lqw:B, 1q1y:A, 3u7k:A, 3u7l:A, 3u7m:A, 3u7n:A |
31 | 2os1:A | 179 | 179 | 0.3128 | 0.3128 | 0.3128 | 5.19e-16 | |
32 | 3cmd:B | 188 | 140 | 0.2682 | 0.2553 | 0.3429 | 7.77e-16 | 3cmd:A, 3g6n:A, 3g6n:B |
33 | 3e3u:A | 196 | 144 | 0.2570 | 0.2347 | 0.3194 | 5.06e-15 | |
34 | 5hgw:A | 174 | 164 | 0.2961 | 0.3046 | 0.3232 | 1.37e-14 | 5hgw:B, 5i2b:A, 5t8z:A |
35 | 5kca:A | 807 | 93 | 0.1453 | 0.0322 | 0.2796 | 0.57 | 5kc8:A |
36 | 8bot:A | 3528 | 69 | 0.1285 | 0.0065 | 0.3333 | 0.88 | |
37 | 7nfe:A | 3585 | 69 | 0.1285 | 0.0064 | 0.3333 | 0.91 | |
38 | 4tsh:B | 485 | 129 | 0.1844 | 0.0680 | 0.2558 | 2.5 | |
39 | 2b1g:A | 590 | 50 | 0.0782 | 0.0237 | 0.2800 | 4.1 | 2b1g:D, 2b1i:A, 2b1i:B, 1g8m:A, 2iu0:B, 2iu3:B, 1m9n:A, 1m9n:B, 1oz0:A, 1oz0:B, 1thz:A, 1thz:B |
40 | 2xon:L | 146 | 51 | 0.1006 | 0.1233 | 0.3529 | 4.3 | 2xom:A, 2xon:A |
41 | 2rar:A | 261 | 73 | 0.0950 | 0.0651 | 0.2329 | 5.4 | 2rav:A, 2rb5:A, 2rbk:A, 1ymq:A |
42 | 8je0:A | 378 | 25 | 0.0615 | 0.0291 | 0.4400 | 6.8 | 8je0:B, 8je0:C, 8je0:D |