SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEK
SGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEK
LD
The query sequence (length=162) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1bs4:A | 168 | 162 | 1.0000 | 0.9643 | 1.0000 | 1.79e-115 | 2ai8:A, 2ai8:B, 2ai8:C, 4al2:B, 4al3:A, 4az4:A, 1bs4:B, 1bs4:C, 1bs5:A, 1bs5:B, 1bs5:C, 1bs6:A, 1bs6:B, 1bs6:C, 1bs8:A, 1bs8:B, 1bs8:C, 1bsj:A, 1bsk:A, 1bsz:A, 1bsz:B, 1bsz:C, 7d6z:g, 1def:A, 2def:A, 1dff:A, 1g27:A, 1g27:B, 1g27:C, 1g2a:A, 1g2a:B, 1g2a:C, 3k6l:A, 3k6l:B, 2kmn:A, 1lru:A, 1lru:B, 1lru:C, 8ofe:A, 8rhr:A, 2w3t:A, 2w3u:A, 1xem:A, 1xen:A, 1xeo:A |
2 | 3fwx:A | 165 | 160 | 0.7099 | 0.6970 | 0.7188 | 3.09e-84 | 3fwx:B |
3 | 4wxl:C | 165 | 160 | 0.6728 | 0.6606 | 0.6813 | 4.12e-74 | 4wxl:A, 4wxl:B, 4wxl:D |
4 | 6jex:A | 172 | 162 | 0.5988 | 0.5640 | 0.5988 | 5.58e-65 | 6jer:A, 6jer:B, 6jet:A, 6jet:B, 6jeu:A, 6jeu:B, 6jev:A, 6jev:B, 6jew:A, 6jew:B, 6jex:B |
5 | 5j46:A | 169 | 163 | 0.5741 | 0.5503 | 0.5706 | 1.23e-64 | |
6 | 1ix1:A | 169 | 161 | 0.5679 | 0.5444 | 0.5714 | 1.81e-61 | 1ix1:B, 1lry:A, 1n5n:A, 1n5n:B, 1s17:A, 1s17:B |
7 | 6ck7:A | 172 | 161 | 0.5062 | 0.4767 | 0.5093 | 1.97e-59 | 6ck7:B, 6ck7:C, 6ck7:D |
8 | 3qu1:A | 168 | 161 | 0.5123 | 0.4940 | 0.5155 | 4.01e-51 | 3qu1:B |
9 | 3oca:A | 179 | 172 | 0.4259 | 0.3855 | 0.4012 | 2.18e-40 | 3oca:B, 3u04:A |
10 | 2ew5:A | 166 | 166 | 0.4198 | 0.4096 | 0.4096 | 2.51e-37 | 4e9a:A, 4e9b:A, 2ew6:A, 2ew7:A |
11 | 4dr8:A | 188 | 146 | 0.4259 | 0.3670 | 0.4726 | 7.09e-33 | 4dr8:B, 4dr8:C, 4dr8:D, 4dr9:A, 4dr9:B, 4dr9:C, 4dr9:D |
12 | 3uwb:A | 149 | 148 | 0.3704 | 0.4027 | 0.4054 | 3.44e-31 | 3uwa:A |
13 | 1y6h:A | 177 | 162 | 0.3765 | 0.3446 | 0.3765 | 1.74e-28 | 1sv2:A, 1sv2:B, 1szz:A, 1szz:B, 1szz:C, 1szz:D, 1szz:E, 1szz:F, 1szz:G, 1szz:H, 1vev:A, 1vev:B, 1vey:A, 1vey:B, 1vez:A, 1vez:B, 1y6h:B |
14 | 1ws1:A | 151 | 147 | 0.3827 | 0.4106 | 0.4218 | 9.86e-28 | |
15 | 5cy7:A | 171 | 148 | 0.3765 | 0.3567 | 0.4122 | 5.47e-27 | 5cp0:A, 5cpd:A, 5cvk:A, 5cvp:A, 5cvq:A, 5cwx:A, 5cwy:A, 5cx0:A, 5cxj:A, 5cy8:A, 6ikt:A, 6iky:A, 6il0:A, 6il2:A, 4nt8:A |
16 | 6jfc:B | 161 | 144 | 0.3333 | 0.3354 | 0.3750 | 7.64e-27 | 6jfa:A, 6jfc:A, 6jfd:C, 6jfe:B, 6jff:B, 6jfn:B |
17 | 5kob:A | 171 | 151 | 0.3519 | 0.3333 | 0.3775 | 1.64e-26 | 5kob:B, 5kob:C, 5kob:D, 5vcp:A, 5vcp:B, 5vcp:C, 5vcp:D |
18 | 6jes:A | 159 | 157 | 0.3704 | 0.3774 | 0.3822 | 1.35e-24 | 6jes:B, 6jf3:A, 6jf3:B, 6jf4:B, 6jf4:A, 6jf5:B, 6jf5:A, 6jf6:C, 6jf6:A, 6jf6:B, 6jf6:D, 6jf7:A, 6jf7:B, 6jf8:A, 6jf8:B, 6jf8:C, 6jf8:D |
19 | 3cpm:A | 184 | 163 | 0.3580 | 0.3152 | 0.3558 | 2.00e-24 | 3m6o:A, 3m6o:B, 3m6p:A, 3m6p:B, 3m6q:A, 3m6r:A, 3m6r:B, 3m6r:C, 3m6r:D, 3o3j:A, 3pn2:A, 3pn3:A, 3pn3:B, 3pn4:A, 3pn5:A, 3pn6:A, 3pn6:B |
20 | 5hgw:A | 174 | 149 | 0.3765 | 0.3506 | 0.4094 | 3.88e-23 | 5hgw:B, 5i2b:A, 5t8z:A |
21 | 3e3u:A | 196 | 162 | 0.3457 | 0.2857 | 0.3457 | 4.73e-22 | |
22 | 1jym:A | 179 | 163 | 0.3457 | 0.3128 | 0.3436 | 7.70e-21 | 1jym:B, 1jym:C, 1jym:D, 1jym:E, 1jym:F, 1jym:G, 1jym:H, 1jym:I, 1jym:J, 1rl4:A, 1rl4:B, 1rqc:A, 1rqc:B, 1rqc:C, 1rqc:D, 1rqc:E, 1rqc:F, 1rqc:G, 1rqc:H, 1rqc:I, 1rqc:J |
23 | 4je6:A | 193 | 175 | 0.3889 | 0.3264 | 0.3600 | 2.25e-19 | 4je6:B, 4je7:A, 4je7:B, 4je8:A, 4je8:B, 1zxz:A, 1zxz:B, 1zy0:A, 1zy0:B, 1zy1:A, 1zy1:B |
24 | 5mtc:A | 137 | 115 | 0.2716 | 0.3212 | 0.3826 | 5.89e-19 | 5mtc:B, 5mtd:A, 5mtd:B, 5mte:A, 5mte:B |
25 | 3g5k:A | 183 | 166 | 0.3333 | 0.2951 | 0.3253 | 3.59e-18 | 3g5k:B, 3g5k:C, 3g5k:D, 3g5p:A, 3g5p:B, 3g5p:C, 3g5p:D |
26 | 1lm4:A | 190 | 114 | 0.2593 | 0.2211 | 0.3684 | 8.63e-16 | 6jfg:A, 6jfo:A, 6jfq:A, 6jfr:A, 6jfs:A, 1lm4:B, 1lmh:A, 1lqw:A, 1lqw:B, 1q1y:A, 3u7k:A, 3u7l:A, 3u7m:A, 3u7n:A |
27 | 2okl:A | 185 | 122 | 0.2716 | 0.2378 | 0.3607 | 3.01e-15 | 2okl:B |
28 | 6ow7:P | 196 | 123 | 0.2593 | 0.2143 | 0.3415 | 9.78e-15 | 2ai7:A, 2aia:A, 2aie:P, 4eox:P, 1lm6:A, 6ow2:P, 6ow7:Q, 3str:P, 3svj:P, 3sw8:P |
29 | 1lqy:A | 184 | 157 | 0.3086 | 0.2717 | 0.3185 | 1.03e-14 | |
30 | 3cmd:B | 188 | 116 | 0.2407 | 0.2074 | 0.3362 | 7.02e-14 | 3cmd:A, 3g6n:A, 3g6n:B |
31 | 2os1:A | 179 | 109 | 0.2346 | 0.2123 | 0.3486 | 1.00e-12 | |
32 | 2os3:A | 205 | 129 | 0.2531 | 0.2000 | 0.3178 | 2.86e-12 | |
33 | 5jex:A | 203 | 129 | 0.2593 | 0.2069 | 0.3256 | 6.00e-12 | 5jez:A, 5jf0:A, 5jf1:A, 5jf2:A, 5jf3:A, 5jf4:A, 5jf5:A, 5jf6:A, 5jf7:A, 5jf8:A |
34 | 3l87:A | 200 | 123 | 0.2407 | 0.1950 | 0.3171 | 6.33e-11 | |
35 | 8p4a:M | 507 | 53 | 0.0988 | 0.0316 | 0.3019 | 0.18 | 8p4b:M, 8w8e:a |
36 | 4dff:B | 277 | 44 | 0.1049 | 0.0614 | 0.3864 | 0.54 | |
37 | 8ab3:A | 330 | 56 | 0.1296 | 0.0636 | 0.3750 | 0.55 | 8ab3:B, 8ab3:C, 8ab3:D |
38 | 4std:A | 164 | 40 | 0.0802 | 0.0793 | 0.3250 | 2.4 | 1std:A, 2std:A, 3std:A, 3std:B, 3std:C, 4std:B, 4std:C, 5std:A, 5std:B, 5std:C, 6std:A, 6std:B, 6std:C, 7std:A, 7std:B, 7std:C |
39 | 8jxu:A | 1410 | 51 | 0.1235 | 0.0142 | 0.3922 | 3.5 | 8jxq:A |
40 | 4jay:A | 338 | 49 | 0.1049 | 0.0503 | 0.3469 | 5.9 | 4jay:B, 4jay:C, 4jay:D, 4jb1:A, 7or2:A, 7orz:A, 7osq:A |
41 | 2cgj:A | 479 | 28 | 0.0617 | 0.0209 | 0.3571 | 6.4 | 2cgl:A, 2uyt:A |
42 | 7a3z:A | 307 | 23 | 0.0679 | 0.0358 | 0.4783 | 7.1 | |
43 | 1olt:A | 434 | 53 | 0.0802 | 0.0300 | 0.2453 | 7.2 | |
44 | 7a5e:A | 338 | 23 | 0.0679 | 0.0325 | 0.4783 | 7.7 | 7a5e:B |