SVIYQTSLMSALLSGVYEGDTTIADLLAHGDFGLGTFNELDGEMIAFSSQVYQLRADGSARAAKPEQKTPFAVMTWFQPQ
YRKTFDAPVSRQQIHDVIDQQIPSDNLFCALRIDGNFRHAHTRTVPRQTPPYRAMTDVLDDQPVFRFNQREGVLVGFRTP
QHMQGINVAGYHEHFITDDRQGGGHLLDYQLESGVLTFGEIHKLMIDLPADSAFLQANLHPSNLDAAIRSVEN
The query sequence (length=233) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5yho:A | 238 | 233 | 0.9914 | 0.9706 | 0.9914 | 3.09e-175 | 6inb:A, 6inc:A, 6j92:A, 6j92:B, 5yho:B |
2 | 5xne:A | 235 | 232 | 0.4163 | 0.4128 | 0.4181 | 1.01e-66 | 6j3d:A, 6j3d:B, 5xne:B |
3 | 4bt2:A | 237 | 219 | 0.3605 | 0.3544 | 0.3836 | 1.85e-56 | 4bt3:A, 4bt4:A, 4bt5:A, 4bt6:A, 4bt7:A |
4 | 1xv2:C | 233 | 236 | 0.3348 | 0.3348 | 0.3305 | 1.33e-40 | 1xv2:A, 1xv2:B, 1xv2:D |
5 | 5uj5:A | 132 | 55 | 0.0901 | 0.1591 | 0.3818 | 1.0 | |
6 | 1qan:A | 236 | 38 | 0.0515 | 0.0508 | 0.3158 | 1.8 | 1qao:A, 1qaq:A |
7 | 6k20:A | 465 | 46 | 0.0644 | 0.0323 | 0.3261 | 5.1 | 6iii:A, 6iny:A, 6lna:A, 6lna:B |
8 | 6gvk:A | 201 | 39 | 0.0601 | 0.0697 | 0.3590 | 5.2 | 6gvl:A |
9 | 7e40:D | 345 | 27 | 0.0472 | 0.0319 | 0.4074 | 5.7 | 7e40:B |
10 | 7wfx:A | 493 | 38 | 0.0558 | 0.0264 | 0.3421 | 9.6 | 7wfx:B, 7wg1:A, 7wg1:B, 7wg2:A, 7wg4:A |