BioLiP

>protein
SVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEDLMKEVVTYRHFMNASGGGVTASGGEA
ILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLEFAKYLANKN
VKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPYHELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQYG
HKVMF

The query sequence (length=245) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3c8f:A	245	245	1.0000	1.0000	1.0000	0.0	3cb8:A, 8fo0:A, 8fol:A, 8fsi:A
2	5hr7:A	360	109	0.1306	0.0889	0.2936	5.02e-04	5hr6:A, 5hr6:B, 5hr7:B, 4pl1:B, 4pl1:A, 4pl2:B, 4pl2:A, 3rf9:A, 3rf9:B, 3rfa:A, 3rfa:B
3	5th5:A	241	189	0.2041	0.2075	0.2646	0.022	5tgs:A, 5tgs:B, 5th5:B, 5th5:C, 5th5:D
4	1dj3:A	432	109	0.1184	0.0671	0.2661	0.15	1dj3:B
5	9ax8:z	509	29	0.0490	0.0236	0.4138	0.65	3jcj:f, 3jcn:b, 5me0:W, 5me1:W, 6o7k:f, 6o9k:z
6	6fz6:A	341	105	0.0980	0.0704	0.2286	0.94	6fz6:B
7	7unv:x	593	37	0.0653	0.0270	0.4324	1.0	7unq:x, 7unr:x, 7unt:x, 7unu:x, 7unw:x
8	4o56:A	244	107	0.0939	0.0943	0.2150	1.2	6ax4:A, 3bzi:A, 3c5l:A, 8crc:A, 4dfw:A, 5dms:A, 5dms:C, 5dmv:C, 5dnj:A, 4e67:A, 4e9c:A, 4e9d:A, 3fvh:A, 6gy2:B, 6gy2:A, 4h71:A, 4hab:A, 4hab:B, 4hab:C, 4hco:A, 3hik:A, 4hy2:A, 5j19:B, 5j19:A, 8joq:A, 8joy:A, 4lkl:A, 4lkm:A, 4lkm:C, 7mso:A, 7mso:B, 7mx1:A, 7mx1:B, 5nei:A, 5nfu:A, 5nje:A, 5nmm:A, 5nn2:A, 4o6w:A, 4o9w:A, 2ojx:A, 3p2z:A, 3p34:A, 3p35:A, 3p35:B, 3p36:A, 3p37:A, 3p37:B, 3p37:C, 3q1i:A, 1q4k:A, 1q4k:B, 1q4k:C, 4rcp:A, 3rq7:A, 8s30:A, 8s31:A, 8s31:B, 1umw:A, 1umw:B, 8wfp:A, 8wfp:B, 4whh:A, 4whk:A, 4whl:A, 5x3s:B, 5x3s:A, 4x9r:A, 4x9v:A, 4x9w:A
9	8jij:A	411	43	0.0571	0.0341	0.3256	2.9	8jik:A
10	2v40:A	419	71	0.0939	0.0549	0.3239	3.6
11	6nhl:B	228	101	0.0980	0.1053	0.2376	4.1	6nhl:A
12	5v1q:B	440	133	0.1184	0.0659	0.2180	4.3	5v1q:A, 5v1s:A, 5v1s:B, 5v1t:A
13	6p2k:B	778	26	0.0449	0.0141	0.4231	5.4	6p2k:A
14	2z77:D	130	50	0.0653	0.1231	0.3200	6.3
15	3cur:H	545	45	0.0653	0.0294	0.3556	7.1	3cur:I, 3cur:J, 3cus:Q, 3cus:R, 3cus:S, 1frf:L, 3h3x:Q, 3h3x:R, 3h3x:S, 4ucq:Q, 4ucq:R, 4ucq:S, 4ucw:Q, 4ucw:R, 4ucw:S, 4ucx:Q, 4ucx:R, 4ucx:S, 4ud2:S, 4ud2:Q, 4ud2:R, 4ud6:Q, 4ud6:R, 4ud6:S, 4ue2:Q, 4ue2:R, 4ue2:S, 4ue6:R, 4ue6:Q, 4ue6:S, 4ueq:Q, 4ueq:R, 4ueq:S, 4ueq:T, 4ueq:U, 4ueq:V, 4uew:Q, 4uew:R, 4uew:S, 4upe:Q, 4upe:R, 4upe:S, 4upv:Q, 4upv:R, 4uql:Q, 4uql:R, 4uqp:Q, 4uqp:R, 4urh:Q, 4urh:S, 4urh:R, 1yqw:Q, 1yqw:R, 1yqw:S, 1yrq:H, 1yrq:I, 1yrq:J, 1yrq:K, 1yrq:M, 1yrq:N
16	3j9w:AS	84	61	0.0571	0.1667	0.2295	7.7	8buu:s, 8cdu:R, 8cdv:R, 8cec:a, 8ced:R, 8cee:R, 6ha1:s, 6ha8:s, 6htq:s, 5njt:S, 7o5b:S, 8qcq:s, 7qgu:x, 7qh4:w, 8qpp:S, 7qv1:s, 7qv2:s, 7qv3:s, 8r55:S
17	1ta9:B	394	80	0.0776	0.0482	0.2375	8.9	1ta9:A
18	5dll:A	854	46	0.0612	0.0176	0.3261	9.3

[Back]