SVEVYRQKIEKGGYSAAYEATRRYEREEIEVLSWSSRWESAWSKFGEAVKALGKIEGAPRALVIAKVQEALAYMSKPLPN
MKLAMAAAVQAVRACEQLPGMNRERCLDAVAGALGVAKDWIRREMT
The query sequence (length=126) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6v7b:a | 126 | 126 | 1.0000 | 1.0000 | 1.0000 | 3.49e-88 | 6v7b:b, 6v7b:c, 6v7b:d, 6v7b:e, 6v7b:f, 6v7b:g, 6v7b:h, 6v7b:i, 6v7b:j, 6v7b:k, 6v7b:l, 6v7b:m, 6v7b:n, 6v7b:o, 6v7b:p, 6v7b:q, 6v7b:r, 6v7b:s, 6v7b:t, 6v7b:u, 6v7b:v, 6v7b:w |
2 | 5yox:A | 183 | 27 | 0.0873 | 0.0601 | 0.4074 | 0.95 | 5yox:B, 5yox:C, 5yox:D, 5yox:E, 5yox:F, 5yox:G, 5yox:H |
3 | 4j1t:E | 373 | 122 | 0.2460 | 0.0831 | 0.2541 | 1.6 | 4j16:A, 4j16:B, 4j1t:B, 4o9u:E, 4o9u:F |
4 | 1qho:A | 686 | 36 | 0.0873 | 0.0160 | 0.3056 | 5.2 | 1qhp:A |
5 | 2or1:L | 63 | 31 | 0.1032 | 0.2063 | 0.4194 | 8.4 | 2or1:R, 1per:L, 1per:R, 1rpe:L, 1rpe:R |
6 | 7tr4:H | 211 | 61 | 0.1270 | 0.0758 | 0.2623 | 8.5 | |
7 | 2qyj:A | 154 | 37 | 0.1032 | 0.0844 | 0.3514 | 8.7 |