SVAIIGPGAVGTTIAYELQQSLPHTTLIGRHAKTITYYTVPHAPAQDIVVKGYEDVTNTFDVIIIAVKTHQLDAVIPHLT
YLAHEDTLIILAQNGYGQLEHIPFKNVCQAVVYISGQKKGDVVTHFRDYQLRIQDNALTRQFRDLVQDSQIDIVLEANIQ
QAIWYKLLVNLGINSITLLGRQTVAIMHNPEIRILCRQLLLDGCRVAQAEGLNFSEQTVDTIMTIYQLEVEAIQGFIYRR
AREHNLDTPYLDTIYSFLRAYQQ
The query sequence (length=263) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4yca:B | 286 | 282 | 0.9962 | 0.9161 | 0.9291 | 0.0 | 4s3m:A, 4s3m:B, 4yca:A |
2 | 4ol9:A | 297 | 289 | 0.3232 | 0.2862 | 0.2941 | 2.25e-25 | |
3 | 2ofp:B | 294 | 230 | 0.1977 | 0.1769 | 0.2261 | 3.01e-09 | 2ofp:A, 1yjq:A, 1yon:A |
4 | 5x20:A | 312 | 310 | 0.2471 | 0.2083 | 0.2097 | 1.34e-08 | 3wfj:A, 3wfj:B, 3wfj:C, 3wfj:D, 3wfj:E, 3wfj:G, 5x20:B, 5x20:C, 5x20:D, 5x20:E |
5 | 5ayv:B | 303 | 294 | 0.2319 | 0.2013 | 0.2075 | 5.22e-06 | 5ayv:A, 5hws:A, 5hws:B, 5hws:C, 5hws:D |
6 | 6d2y:A | 428 | 64 | 0.0722 | 0.0444 | 0.2969 | 3.59e-04 | |
7 | 3wfj:F | 263 | 294 | 0.2357 | 0.2357 | 0.2109 | 0.035 | 3wfj:H |
8 | 8ix9:C | 314 | 81 | 0.0798 | 0.0669 | 0.2593 | 0.051 | 8ix9:B, 8ix9:A, 8ixh:A, 8ixh:B, 8ixh:C, 8ixm:A, 8ixm:B |
9 | 3hwr:A | 299 | 125 | 0.0913 | 0.0803 | 0.1920 | 0.21 | 3hwr:B |
10 | 2wzn:A | 338 | 185 | 0.1673 | 0.1302 | 0.2378 | 0.36 | 4x8i:A, 4x8i:B, 4x8i:C |
11 | 7q2a:B | 352 | 53 | 0.0684 | 0.0511 | 0.3396 | 0.36 | 3lm4:A, 3lm4:B, 3lm4:C, 3lm4:D, 7q2a:A, 7q2a:C, 7q2a:D |
12 | 6chd:A | 506 | 48 | 0.0570 | 0.0296 | 0.3125 | 1.4 | 3bju:A, 3bju:B, 3bju:C, 3bju:D, 6chd:B, 4dpg:A, 4dpg:B, 4dpg:C, 4dpg:D, 4dpg:E, 4dpg:F, 4dpg:G, 4dpg:H, 7ea9:A, 7ea9:B, 7ea9:C, 7ea9:D, 6ild:A, 6ild:B, 6ilh:A, 6ilh:B, 4ycu:A, 4ycu:B, 4ycw:A, 4ycw:B, 4ycw:E, 4ycw:F |
13 | 2dwc:B | 409 | 96 | 0.0875 | 0.0562 | 0.2396 | 1.5 | 2dwc:A |
14 | 8vxa:A | 1139 | 95 | 0.0875 | 0.0202 | 0.2421 | 3.6 | 8vxc:A |
15 | 8vxy:B | 1161 | 95 | 0.0875 | 0.0198 | 0.2421 | 3.8 | |
16 | 6tmf:C | 193 | 56 | 0.0646 | 0.0881 | 0.3036 | 4.0 | |
17 | 6sw9:Z | 197 | 56 | 0.0684 | 0.0914 | 0.3214 | 4.6 | 5jb3:Z, 5jbh:Z, 6skf:Ac, 6skg:Ac, 6swc:Z, 6swe:Z, 6th6:Ac, 4v4n:BC, 4v6u:AC, 7zag:Z, 7zah:Z, 7zai:Z, 7zhg:Z |
18 | 4x9m:A | 384 | 30 | 0.0494 | 0.0339 | 0.4333 | 6.0 | 4x9n:A |
19 | 7mfm:I | 490 | 145 | 0.1483 | 0.0796 | 0.2690 | 6.0 | 7mfm:J, 7mft:I |
20 | 3k57:A | 782 | 140 | 0.1103 | 0.0371 | 0.2071 | 7.8 | 3k58:A, 3k59:A, 3k5l:A, 3k5m:A, 3maq:A |
21 | 5hc9:A | 425 | 36 | 0.0418 | 0.0259 | 0.3056 | 8.7 | 3h39:A, 3h39:B, 3h3a:A, 3h3a:B, 5hc9:B |
22 | 4up7:A | 529 | 64 | 0.0760 | 0.0378 | 0.3125 | 8.9 | 4up9:A, 4upa:A |
23 | 6dtq:A | 391 | 49 | 0.0494 | 0.0332 | 0.2653 | 9.9 | 6dtq:B, 6dtq:C, 6dtq:D |