SVAIDLPYDKRTITAQIDDENYAGKLVSQAATYHNKLSEQETVEKSLDNPIGSDKLEELARGKHNIVIISSDHTRPVPSH
IITPILLRRLRSVAPDAAIAILVATGFHRPSTHEELVNKYGEDIVNNEEIVMHVSTDDSSMVKIGQLPSGGDCIINKVAA
EADLLISEGFIESHFFAGFSGGRKSVLPGIASYKTIMANHSGEFARTGNLMHNSIHKDMVYAARTAKLAFIINVVLDEDK
KIIGSFAGDMEAAHKVGCDFVKELSSVPAIDCDIAISTNGGYPLDQNIYQAVKGMTAAEATNKEGGTIIMVAGARDGHGG
EGFYHNLADVDDPKEFLDQIPDQWTAQIFARILVHHHVIFVSDLVDPDLITNMHMELAKTLDEAMEKAYAREGQAAKVTV
IPDGLGVIVKASWSHP
The query sequence (length=416) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5huq:A | 433 | 430 | 0.9952 | 0.9561 | 0.9628 | 0.0 | 6c1w:A, 6c1w:B, 6c1w:C, 8ezf:B, 8ezh:B, 8ezi:B, 5huq:B |
2 | 2yjg:A | 418 | 421 | 0.5288 | 0.5263 | 0.5226 | 1.89e-151 | 2yjg:B |
3 | 8tec:A | 448 | 84 | 0.0577 | 0.0536 | 0.2857 | 1.7 | 8tee:A, 8tee:B |
4 | 1r9d:A | 786 | 67 | 0.0457 | 0.0242 | 0.2836 | 2.1 | 1r9d:B |
5 | 6pzv:G | 242 | 49 | 0.0385 | 0.0661 | 0.3265 | 5.0 | 6pzv:C |
6 | 1bgp:A | 309 | 61 | 0.0409 | 0.0550 | 0.2787 | 8.7 |