SVAAGPFAHDRSSVNRIMLDVCLALTPATLFGLVMFGWPAINLWLVTCVSALAIEAACLRLLGQPMRRLLDGSALLTGWL
LAISLPPWAPWWIGVGGSLFAIGIGKQLYGGIGQNPFNPAMLARVALLIAFPLQMTTWALPHPLFSSSAPGFFDSLAITF
AGAPLADGMTGATALGNLKTELTLNRTAQEILEGGFSTISALFGSTPGSLGETSELLLLVGGVWLVLRRIIHWEIPVAIL
ASVFVMATLAYLINPERYAGGLYQLTSGGLILCAFFIATDPVTSPISRVGRLIFGVGCGVLIYVIRTWGSFPEAAAFAVL
FMNALTPLIDRYWRPRAYGRNVRGKPLVA
The query sequence (length=349) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ahx:D | 349 | 349 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8rb8:D, 8rb9:D, 8rbm:D |
2 | 8rbq:D | 305 | 349 | 0.8739 | 1.0000 | 0.8739 | 0.0 | |
3 | 7zc6:D | 304 | 340 | 0.3524 | 0.4046 | 0.3618 | 2.30e-59 | |
4 | 8a1w:B | 412 | 285 | 0.2378 | 0.2015 | 0.2912 | 3.81e-26 | 8a1t:B, 8a1u:B, 8a1v:B, 8a1x:B, 8a1y:B, 8acw:B, 8acy:B, 8ad0:B, 8evu:B, 8ew3:B, 7xk3:B, 7xk4:B, 7xk5:B, 7xk6:B, 7xk7:B |
5 | 3kfu:E | 468 | 106 | 0.0888 | 0.0662 | 0.2925 | 2.8 | 3kfu:H |
6 | 4uyq:A | 143 | 63 | 0.0430 | 0.1049 | 0.2381 | 3.9 | |
7 | 7w02:A | 1566 | 97 | 0.0630 | 0.0140 | 0.2268 | 4.2 | |
8 | 4lsb:B | 278 | 74 | 0.0630 | 0.0791 | 0.2973 | 4.6 | 4lsb:A |
9 | 7y1u:A | 723 | 83 | 0.0602 | 0.0290 | 0.2530 | 6.4 | |
10 | 3gdv:B | 284 | 69 | 0.0630 | 0.0775 | 0.3188 | 9.4 | 3gdu:B, 2r3y:A, 4rqz:A, 4rqz:B, 4rqz:C |