BioLiP

>protein
STTTKYIFVPIATIGCGKTTVFNTLNNLFPQWTHIQNNNISKKAKLKICDLTLLALEDDDQSVVLFDRNNSASRERRQIF
TTIDQKRDEHLDDTVDLKYIAINFIPEDLSEEELWDITYNRVIQRGDNHQSIKSQLDENLVESVMKGFIQRYQPINTSRS
PDDQFDHVIHLKLSKDENSLKSSLENVRIIIDDLVQNFPDLIKEKPADELINECFQKALDYKP

The query sequence (length=223) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6u05:A	413	222	0.9417	0.5085	0.9459	4.39e-149	6tzm:A, 6tzo:A, 6tzx:A, 6u00:B, 6u03:A, 5u32:A
2	8pj1:s	159	37	0.0583	0.0818	0.3514	0.066	7a09:4, 8oz0:U, 8ppl:Is, 7qp6:s, 6ybv:s, 6zmw:s, 6zp4:4
3	3ai7:A	813	77	0.0987	0.0271	0.2857	0.81	3ai7:B, 3ai7:C, 3ai7:D, 3ai7:E, 3ai7:F, 3ai7:G, 3ai7:H, 7c8h:A, 7c8h:B, 7c8h:C, 7c8h:D, 7c8h:E, 7c8h:F, 7c8h:G, 7c8h:H, 7c8i:A, 7c8i:B, 7c8i:C, 7c8i:D, 7c8i:E, 7c8i:F, 7c8i:G, 7c8i:H, 8io6:A, 8io6:B, 8io6:C, 8io6:D, 8io6:E, 8io6:F, 8io6:G, 8io6:H, 8io7:A, 8io7:B, 6lxv:A, 6lxv:B, 6lxv:C, 6lxv:D, 6lxv:E, 6lxv:F, 6lxv:G, 6lxv:H
4	1ej8:A	140	75	0.1076	0.1714	0.3200	1.2
5	8vxa:A	1139	151	0.1570	0.0307	0.2318	2.1	8vxc:A
6	8vxy:B	1161	151	0.1570	0.0301	0.2318	2.6
7	3ahc:A	802	65	0.0807	0.0224	0.2769	8.5	3ahd:A, 3ahe:A, 3ahf:A, 3ahg:A, 3ahh:A, 3ahi:A, 3ahj:A
8	2v1u:A	382	54	0.0583	0.0340	0.2407	8.6
9	4y4m:F	262	23	0.0493	0.0420	0.4783	8.6	4y4m:A, 4y4m:B, 4y4m:C, 4y4m:D, 4y4m:E, 4y4m:G, 4y4m:H

[Back]