BioLiP

>protein
STSLLFEQLNFLILVAAEAELPIAHSTRKLLMDNSCNNCQIYELYNENLKDVKTDKDWFMNKFGPQTVHFVISNTINFPF
YKIVYFDLLIPVVSHTWVQDSVKTKRHLRTNMYSPNPFHLLRDCQVYISKSSFNKCEYILYSDLLHLLGGTLVNYISNRT
THVIVQSPQDPIIATVSKLTEWKFVYPIWILYHFKMAKPLKGELATLCELDMQDTSEEQLFAKWEEVIGDKQTSSSQLTL
HPNKTLFKNHHFAISPDLNFFTPLYWFLKGFIEDLDGKVTPLSFSDDLKSVYQAFPDIDCYIGHSANSPILEKTKSIKPE
IHVGNVSWLFYMFALQKFTPVSQCKLIHQPFHAKLFTSKELTVAYTNYFGSQRFYIQRLVEILGGLSTPELTRKNTHLIT
KSTIGKKFKVAKKWSLDPQNAIIVTNHMWLEQCYMNNSKLNPKDSRFQNFKLDDNMGWNIGQIGMD

The query sequence (length=466) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6j0x:B	466	466	1.0000	1.0000	1.0000	0.0	6j0w:A, 6j0w:B, 6j0x:A, 6j0x:C, 6j0x:D
2	6hm3:A	183	194	0.1073	0.2732	0.2577	3.12e-07	4bu0:A, 4bu1:A, 4bu1:B, 6hm4:A
3	5u6k:E	191	88	0.0536	0.1309	0.2841	0.004	5u6k:A, 5u6k:B, 5u6k:C, 5u6k:D
4	6rmm:D	190	110	0.0622	0.1526	0.2636	0.044	6rmm:C, 3ueo:B, 3ueo:D, 3ueo:A, 3ueo:C
5	6rml:B	278	55	0.0365	0.0612	0.3091	0.94
6	6rml:B	278	52	0.0322	0.0540	0.2885	4.2
7	7dqx:D	770	39	0.0300	0.0182	0.3590	1.8	7dqx:A
8	6hm5:A	251	56	0.0343	0.0637	0.2857	5.1
9	3crw:1	485	72	0.0365	0.0351	0.2361	5.6
10	8hio:D	152	33	0.0236	0.0724	0.3333	8.9

[Back]