STQSHMFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQ
MYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQK
The query sequence (length=112) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3qzc:B | 112 | 112 | 1.0000 | 1.0000 | 1.0000 | 5.39e-79 | 3qzc:A |
2 | 6bie:B | 97 | 97 | 0.2679 | 0.3093 | 0.3093 | 3.28e-11 | 6owx:B, 5wnw:B, 5wo1:A, 5wo1:B, 5wo2:B, 5wo3:B |
3 | 7rx2:B | 615 | 53 | 0.1161 | 0.0211 | 0.2453 | 4.0 | 6e0h:B, 6e0h:A, 6e1o:B, 6e1o:A, 7rwj:B, 7rwj:A, 7rx2:A |
4 | 7rxg:B | 650 | 53 | 0.1161 | 0.0200 | 0.2453 | 4.5 | 7rxg:A, 7rxh:A |
5 | 2y4q:A | 79 | 19 | 0.0893 | 0.1266 | 0.5263 | 7.6 | |
6 | 6z1p:AC | 284 | 63 | 0.1786 | 0.0704 | 0.3175 | 8.9 | |
7 | 8p97:A | 623 | 32 | 0.0982 | 0.0177 | 0.3438 | 9.7 |