STLEIAGLVRKNLVQFGVGEKNGSVRWVMNALGVKDDWLLVPSHAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDV
GFQDVVLMKVPTIPKFRDITQHFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKATYVHKKNDGTTVDLTVDQA
WRGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNI
The query sequence (length=212) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1qa7:B | 217 | 212 | 0.9953 | 0.9724 | 0.9953 | 6.36e-158 | 2a4o:A, 2cxv:A, 2h6m:A, 2h9h:A, 2hal:A, 1qa7:A, 1qa7:C, 1qa7:D |
2 | 2wv4:A | 201 | 195 | 0.2406 | 0.2537 | 0.2615 | 0.002 | 2wv4:B, 2wv5:A, 2wv5:B, 2wv5:C, 2wv5:D |
3 | 8d8i:A | 201 | 51 | 0.0755 | 0.0796 | 0.3137 | 0.85 | 3n00:A |
4 | 1t8h:A | 272 | 65 | 0.0802 | 0.0625 | 0.2615 | 4.6 | 6t0y:A, 6t1b:A |
5 | 1smr:A | 331 | 61 | 0.0802 | 0.0514 | 0.2787 | 6.8 | 1smr:C, 1smr:E, 1smr:G |