Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
STKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEFSPSI
AREIYEMYEAVS

The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 3bdn:A 234 92 0.9674 0.3803 0.9674 1.54e-59 3bdn:B, 2hnf:A, 2ho0:A, 1lli:A, 1lli:B, 1lmb:3, 1lmb:4, 1rio:A, 1rio:B
2 7jvt:D 199 90 0.9457 0.4372 0.9667 3.51e-58 7jvt:C
3 3woa:A 413 88 0.5870 0.1308 0.6136 7.72e-23
4 8tac:B 66 47 0.1848 0.2576 0.3617 3.44e-05
5 2bji:A 274 29 0.1413 0.0474 0.4483 1.2 2bji:B
6 2or1:L 63 29 0.1522 0.2222 0.4828 1.3 2or1:R, 1per:L, 1per:R, 1rpe:L, 1rpe:R
7 7ol9:B 203 18 0.1196 0.0542 0.6111 2.0 7ol9:A, 6y93:A, 6y93:B
8 5xyi:N 150 52 0.1739 0.1067 0.3077 4.4
9 3pbl:A 432 49 0.1848 0.0394 0.3469 5.9 3pbl:B
10 2wys:B 516 34 0.1630 0.0291 0.4412 7.6 2w5f:A, 2w5f:B, 2wys:A, 2wze:A, 2wze:B
11 4as5:A 274 29 0.1196 0.0401 0.3793 8.6 4as5:B, 4as5:C, 4as5:D
12 8xte:A 395 37 0.1630 0.0380 0.4054 8.7 8xte:B, 8xte:C, 8xte:D, 8xte:E, 8xte:F, 8xtf:A, 8xtg:A, 8xtg:B, 8xtg:C, 8xtg:D, 8xtg:E, 8xtg:F

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218