STKDRHTKVEGRGRRIRMPAMCAARVFQLTRELGHKSDGETIEWLLQQAEPAVIAATG
The query sequence (length=58) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7vp3:C | 62 | 57 | 0.9828 | 0.9194 | 1.0000 | 1.33e-37 | 7vp3:D, 7vp3:J, 7vp3:G, 7vp3:L, 7vp3:I, 7vp3:N, 7vp3:P |
2 | 7vp2:A | 83 | 55 | 0.3276 | 0.2289 | 0.3455 | 6.47e-06 | 7vp1:A, 7vp1:B, 7vp2:B, 7vp4:B, 7vp4:A, 7vp4:F, 7vp4:E, 7vp4:J, 7vp4:I, 7vp5:A, 7vp5:B, 7vp5:E, 7vp5:F, 7vp5:I, 7vp5:J, 7vp7:A, 7vp7:B |
3 | 5k3i:A | 661 | 26 | 0.2414 | 0.0212 | 0.5385 | 0.032 | 5k3i:B, 5k3i:C, 5k3i:D, 5k3i:E, 5k3i:F, 5k3i:G, 5k3i:H |
4 | 7jrq:A | 127 | 39 | 0.2069 | 0.0945 | 0.3077 | 0.30 | |
5 | 4lrt:B | 295 | 20 | 0.1552 | 0.0305 | 0.4500 | 2.2 | 4lrs:B, 4lrt:D |
6 | 5tgy:A | 109 | 39 | 0.1724 | 0.0917 | 0.2564 | 7.5 | |
7 | 5lqw:A | 2130 | 15 | 0.1552 | 0.0042 | 0.6000 | 10.0 | |
8 | 7dco:A | 2205 | 15 | 0.1552 | 0.0041 | 0.6000 | 10.0 | 7b9v:A, 5gm6:A, 3jcm:A, 5lj5:A, 5zwm:A, 5zwo:A |