STGVELYLDLLKRTVSNFIYQDATHVAGLITQAAFVEEARESGEDYPTVAHTAIGMKRLNNLQHCVESALRDGVPGDVLE
TGVWRGGACIFARGILKAYDVRDRTVWVADSFQGFPKITDDDHPMDAEMNLHQYNAAVDLPTSLATVQRNFSRYGLLDDQ
VRFLPGWFKDTMPTAPFERLAVLRMDGDSYGATMDVLTHAYPRLSPGGFAIIDDYCIPACREAVHEYRDRHGISDEIVEI
DRQGVYWRRS
The query sequence (length=250) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4x7u:A | 252 | 250 | 0.9880 | 0.9802 | 0.9880 | 0.0 | 4x7u:B, 4x7v:A, 4x7v:B, 4x7w:A, 4x7w:B, 4x7x:A, 4x7x:B, 4x7y:B, 4x7y:A, 4x7z:A, 4x7z:B, 4x81:A, 4x81:B, 4xvy:A, 4xvy:B |
2 | 4xvz:C | 203 | 250 | 0.7760 | 0.9557 | 0.7760 | 1.15e-133 | 4xvz:A, 4xvz:B, 4xvz:D |
3 | 2wk1:A | 242 | 246 | 0.5400 | 0.5579 | 0.5488 | 5.12e-97 | |
4 | 4ce0:A | 213 | 245 | 0.5400 | 0.6338 | 0.5510 | 1.09e-91 | 4cdz:A |
5 | 5i10:A | 192 | 245 | 0.4960 | 0.6458 | 0.5061 | 1.36e-80 | |
6 | 3tos:B | 257 | 155 | 0.1600 | 0.1556 | 0.2581 | 0.15 | 4gf5:A, 4gf5:C, 4gf5:E, 4gf5:F, 4gf5:H, 4gf5:B, 4gf5:D, 4gf5:G, 4gf5:I, 4gf5:J, 4gf5:K, 4gf5:L, 4gf5:M, 4gf5:N, 4gf5:O, 4gf5:P, 4gf5:Q, 4gf5:R, 4gf5:S, 4gf5:T, 3tos:A, 3tos:C, 3tos:D, 3tos:E, 3tos:F, 3tos:G, 3tos:H, 3tos:I, 3tos:J |
7 | 3ubl:A | 212 | 52 | 0.0640 | 0.0755 | 0.3077 | 0.34 | 3ubl:B |
8 | 5ncc:A | 578 | 92 | 0.1040 | 0.0450 | 0.2826 | 0.66 | 7av4:AAA, 5ncc:B, 5ncc:C, 5ncc:D, 5ncc:E, 5ncc:F, 7r33:A, 7r33:B, 7r34:A, 7r34:B, 7r35:A, 7r35:B, 7r36:A, 7r36:B, 6yru:AAA, 6yrv:AAA, 6yrx:AAA, 6yrz:AAA, 6ys1:AAA, 6ys2:AAA, 6zh7:A, 6zh7:B |
9 | 2h5n:A | 132 | 24 | 0.0440 | 0.0833 | 0.4583 | 1.0 | 2h5n:B, 2h5n:C |
10 | 7etj:M | 468 | 75 | 0.0760 | 0.0406 | 0.2533 | 2.9 | |
11 | 8ofi:A | 452 | 77 | 0.0960 | 0.0531 | 0.3117 | 3.0 | |
12 | 6gyo:A | 501 | 77 | 0.0960 | 0.0479 | 0.3117 | 3.0 | 3etq:A, 3etq:B, 6gyo:B, 6gyo:C, 6gyo:D, 4hbn:A, 4kl1:A, 4kl1:B, 4kl1:C, 4kl1:D, 7np4:A, 7np4:B, 7np4:C, 7np4:D, 4nvp:A, 3otf:A, 3u11:A, 3u11:B |
13 | 5jon:A | 509 | 77 | 0.0960 | 0.0472 | 0.3117 | 4.8 | 5jon:B |