BioLiP

>protein
STFEEAFNKLLKEVLEFNLENPFEDAKKVICIEPHPDDCAIGMGGTIKKLSDEGVEVIYICMTDGYMGTTDEKLSGHELA
LIRRREEEESAKLLGVRKIYWLNYRDTELPYSREVRKDLVKIIRKEKPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFS
QLPNFSNIDIDIGLKPHSVSFIALYYTHKPNYIVDITDLMELKLKAIRAHRSQFTDDIWETWEPFLRTVTMFYGEKIGVR
YGEGFRVMPGLFYHITPFADLI

The query sequence (length=262) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3wl4:A	267	262	1.0000	0.9813	1.0000	0.0	3wl4:B, 4xm0:A, 4xm0:B, 4xm0:C, 4xm0:D, 4xm0:E, 4xm0:F, 4xm1:A, 4xm1:B, 4xm1:C, 4xm1:D, 4xm1:E, 4xm1:F, 4xm2:A, 4xm2:B, 4xm2:C, 4xm2:D, 4xm2:E, 4xm2:F
2	5b2e:A	267	262	0.8893	0.8727	0.8893	5.69e-179	5b2e:B, 5b2e:C, 5b2f:A, 5b2f:B, 5b2f:C, 3we7:A, 3we7:B, 3we7:C, 3wl3:A, 3wl3:B, 3wl3:C
3	8bgo:G	271	262	0.8130	0.7860	0.8130	1.35e-168	8bgn:A, 8bgn:B, 8bgn:C, 8bgo:A, 8bgo:H, 8bgo:K, 8bgo:B, 8bgo:E, 8bgo:L, 8bgo:C, 8bgo:I, 8bgo:J, 8bgo:F, 8bgo:D, 8bgp:A, 8bgp:B, 8bgp:C, 8bgp:D, 8bgp:E, 8bgp:F
4	2ixd:A	232	245	0.2939	0.3319	0.3143	2.02e-24	2ixd:B
5	6p2t:A	232	227	0.2557	0.2888	0.2952	2.79e-24	6ull:A
6	1q7t:A	310	154	0.1412	0.1194	0.2403	0.031	4ewl:A, 4ewl:B, 1q74:A, 1q74:B, 1q74:C, 1q74:D, 1q7t:B
7	3dfi:A	242	145	0.1489	0.1612	0.2690	0.048
8	5cgz:A	240	206	0.1527	0.1667	0.1942	0.32	5cgz:B
9	7lgp:B	377	170	0.1679	0.1167	0.2588	3.2	7lgp:A
10	8cmo:K	89	66	0.0534	0.1573	0.2121	4.3
11	1pl6:A	356	39	0.0496	0.0365	0.3333	6.5	1pl6:B, 1pl6:C, 1pl6:D, 1pl7:A, 1pl7:B, 1pl7:C, 1pl7:D, 1pl8:A, 1pl8:B, 1pl8:C, 1pl8:D
12	6iiy:A	237	38	0.0344	0.0380	0.2368	9.6

[Back]