STEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTV
PPEPVDFQLLTQQVIQCAYDIAKAAKQLVTITT
The query sequence (length=113) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6jmu:A | 127 | 116 | 1.0000 | 0.8898 | 0.9741 | 3.59e-77 | 6iui:B, 6iui:A, 6jmu:B |
2 | 8a0m:B | 964 | 59 | 0.1593 | 0.0187 | 0.3051 | 5.0 | |
3 | 5hp8:A | 108 | 91 | 0.2655 | 0.2778 | 0.3297 | 6.2 | 5hp8:B, 5hp8:C |
4 | 4f2n:B | 210 | 34 | 0.0973 | 0.0524 | 0.3235 | 7.3 | 4f2n:A, 4f2n:C, 4f2n:D, 4f2n:E, 4f2n:F, 4f2n:G, 4f2n:H, 4f2n:I, 4f2n:J, 4f2n:K, 4f2n:L |