SSYPIGAPIPWPSDSVPAGFALMEGQTFDKSAYPKLAVAYPSGVIPDMRGQTIKGKPSGRAVLSAEADGVKAHSHSASAS
STDLGTKTTSSFDYGTKGTNSTGGHTHSGSGSTSTNGEHSHYIEAWNGTGVGGNKMSSYAISYRAGGSNTNAAGNHSHTF
SFGTSSAGDHSHSVGIGAHTHTVAIGSHGHTITVNSTGNTENTVKNIAFNYIVRLA
The query sequence (length=216) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2xgf:A | 216 | 216 | 1.0000 | 1.0000 | 1.0000 | 5.64e-155 | 2xgf:B, 2xgf:C |
2 | 5ks8:F | 482 | 46 | 0.0741 | 0.0332 | 0.3478 | 0.066 | |
3 | 5iv5:O | 526 | 68 | 0.1065 | 0.0437 | 0.3382 | 0.53 | 5iv5:P, 5iv5:Q, 5iv5:l, 5iv5:m, 5iv5:n, 5iv5:AI, 5iv5:AJ, 5iv5:BA, 5iv5:DB, 5iv5:DC, 5iv5:DD, 5iv5:FE, 5iv5:FF, 5iv5:FG, 5iv5:HH, 5iv5:HI, 5iv5:HJ, 1ocy:A |
4 | 6b9t:D | 453 | 45 | 0.0648 | 0.0309 | 0.3111 | 2.0 | 6b9s:A, 6b9s:D, 6b9s:C, 6b9s:G, 6b9s:E, 6b9t:A, 6b9t:B, 6b9t:C, 6b9t:E, 6b9t:F, 6b9t:G, 6b9t:H |
5 | 2xf3:B | 428 | 38 | 0.0648 | 0.0327 | 0.3684 | 3.0 | 2xf3:A, 2xfs:A, 2xfs:B, 2xh9:A, 2xh9:B |
6 | 6aqh:B | 490 | 120 | 0.1435 | 0.0633 | 0.2583 | 6.0 | 6aqh:A, 6aqh:C, 6aqh:D |
7 | 4zfq:A | 346 | 146 | 0.1713 | 0.1069 | 0.2534 | 6.6 | |
8 | 4v2x:A | 534 | 83 | 0.1296 | 0.0524 | 0.3373 | 7.5 | |
9 | 5wol:A | 230 | 85 | 0.1157 | 0.1087 | 0.2941 | 9.3 |