SSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENLLYAGFLGVFLGGRIGYVLFYNF
PQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRTKRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPF
AMLFPGSRTEDILLLQTNPQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRIIV
EFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSP
The query sequence (length=284) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5azb:A | 284 | 284 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 5azc:A |
2 | 5vm8:B | 237 | 27 | 0.0458 | 0.0549 | 0.4815 | 0.89 | |
3 | 6jhb:B | 264 | 37 | 0.0493 | 0.0530 | 0.3784 | 1.0 | 6jha:B |
4 | 8e6n:A | 398 | 52 | 0.0599 | 0.0427 | 0.3269 | 1.7 | 8e60:A, 8e6h:A, 8e6i:A, 8e6l:A |
5 | 4n8i:A | 440 | 87 | 0.0845 | 0.0545 | 0.2759 | 5.1 | 4n8i:B, 4n8j:C, 4n8j:D |
6 | 7lx0:H | 739 | 53 | 0.0634 | 0.0244 | 0.3396 | 8.1 | 7lx0:b, 7lx0:B, 6pnj:H, 6pnj:B, 6pnj:b |