SSRISALEYATTRKKSEVVYSGVSVTIPTAPTNLVSLLKTLTPSSGTLAPFFDTVNNKMVVFNENKTLFFKLSIVGTWPS
GTANRSMQLTFSGSVPDTLVSSRNSATTTDNILLATFFSVDKDGFLATNGSTLTIQSNGAAFTATTIKIIAEQ
The query sequence (length=153) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4k6b:B | 156 | 153 | 1.0000 | 0.9808 | 1.0000 | 1.22e-106 | 4k6b:A, 4k6b:C, 3rwn:A, 3rwn:C, 3rwn:B |
2 | 5t2a:AP | 223 | 39 | 0.1111 | 0.0762 | 0.4359 | 0.24 | 8a3w:SF, 8a98:SF, 6az1:F, 8ovj:SF, 8rxh:SF, 8rxx:SF |
3 | 2r0l:A | 239 | 42 | 0.0784 | 0.0502 | 0.2857 | 1.4 | 3k2u:A, 2wub:A, 2wub:C, 2wuc:A |
4 | 5kar:A | 412 | 89 | 0.1634 | 0.0607 | 0.2809 | 3.3 | 5kas:A |
5 | 7uve:A | 229 | 32 | 0.0784 | 0.0524 | 0.3750 | 3.7 | |
6 | 1jnn:H | 214 | 73 | 0.1438 | 0.1028 | 0.3014 | 6.9 | |
7 | 6yxy:AE | 434 | 50 | 0.1111 | 0.0392 | 0.3400 | 7.8 | 7aih:A, 7am2:A, 7ane:A, 7aoi:AE, 6yxx:AE |