BioLiP

>protein
SSQQVWKLVIITEEILLKKVSKIIKEAGASGYTVLAAAGEGSRNVRSTGEPSVSHAYSNIKFEVLTASRELADQIQDKVV
AKYFDDYSCITYISTVEAL

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6ntb:C	104	99	1.0000	0.9519	1.0000	2.86e-68	6mm2:A, 6ntb:A, 6ntb:B
2	6mmo:A	91	99	0.8687	0.9451	0.8687	2.79e-53	6mmc:A, 6mmo:B, 6mmo:C, 6mmo:E, 6mmo:D, 6mmo:F, 6mmq:A, 6mmq:D, 6mmq:B, 6mmq:C, 6mmq:F, 6mmq:E
3	7cyf:D	109	93	0.5556	0.5046	0.5914	4.33e-37	7cyf:E, 7cyf:F, 7egk:D, 7egk:F, 7egk:B, 7obj:A, 7obj:B, 7r2y:C, 7r31:A, 7r31:B, 7r31:C, 7r32:B, 7r32:C
4	7r30:B	102	93	0.4747	0.4608	0.5054	3.00e-27	5o3q:A, 5o3q:C, 5o3q:B, 5o3r:A, 5o3r:B, 5o3r:C, 7obj:C, 7r2y:A, 7r2y:B, 7r2z:A, 7r2z:B, 7r2z:C, 7r30:A, 7r30:C, 7r32:A
5	7o4x:A	103	29	0.1111	0.1068	0.3793	0.41
6	6ow4:F	284	51	0.1616	0.0563	0.3137	0.80	6ow4:A, 6ow4:B, 6ow4:C, 6ow4:D, 6ow4:E, 6ow4:G, 6ow4:H
7	1pto:B	196	27	0.1212	0.0612	0.4444	2.6
8	5xkt:A	199	26	0.0909	0.0452	0.3462	3.6	5xkt:B
9	4wa6:D	415	25	0.1010	0.0241	0.4000	6.1	4w4u:D
10	4fjc:E	434	25	0.1010	0.0230	0.4000	6.1	3m99:A, 3mhh:A
11	7w1y:2	706	42	0.1414	0.0198	0.3333	6.1	7pfo:2, 7plo:2, 8q6o:A, 8q6o:2, 8q6p:2, 7w1y:A, 6xtx:2, 6xty:2
12	3mhs:A	455	25	0.1010	0.0220	0.4000	6.2	6aqr:A, 4fip:A, 4fip:E, 4fjc:A, 4fk5:A, 6t9l:K, 4w4u:A, 4wa6:A, 4zux:U, 4zux:Z, 4zux:e, 4zux:j
13	4oh1:A	351	71	0.2020	0.0570	0.2817	6.3
14	8osi:A	400	57	0.1616	0.0400	0.2807	6.6
15	4ggv:A	396	35	0.1414	0.0354	0.4000	7.2
16	8b9d:2	576	42	0.1414	0.0243	0.3333	7.3
17	4eo3:A	321	23	0.0909	0.0280	0.3913	7.7	4eo3:B
18	1z82:A	312	72	0.1717	0.0545	0.2361	8.8	1z82:B

[Back]