BioLiP

>protein
SSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEA

The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8i0r:v	173	75	1.0000	0.4335	1.0000	1.62e-51	7abg:F, 7abh:F, 6ff4:7, 6ff7:7, 8i0p:v, 8i0t:v, 7q4o:1, 7q4p:1, 8qo9:G, 6qx9:A2, 8qxd:8, 8r0a:8, 8r0b:8, 8rm5:8, 7vpx:B
2	8ch6:I	185	72	0.8800	0.3568	0.9167	4.03e-43	7abi:F, 7onb:M, 7qtt:I, 5z56:v, 5z57:v
3	5nrl:U	196	47	0.2800	0.1071	0.4468	1.24e-07
4	7dco:v	207	47	0.2800	0.1014	0.4468	1.24e-07	5gm6:I, 5zwm:v, 5zwo:v
5	6g90:U	196	47	0.2800	0.1071	0.4468	1.28e-07	7oqb:U, 7oqe:U
6	8qzs:r	114	36	0.1733	0.1140	0.3611	0.002	7abf:N, 7abg:N, 7abi:N, 8h6k:4N, 5o9z:N, 8q7n:r, 8qpe:r
7	8idf:A	459	40	0.2000	0.0327	0.3750	0.015
8	8pv1:Cb	101	32	0.1600	0.1188	0.3750	0.81	8pv2:Cb, 8pv3:Cb, 8pv4:Cb, 8pv5:Cb, 8pv6:Cb, 8pv7:Cb, 8pv8:Cb, 8pvk:Cb, 8pvl:Cb
9	1zu1:A	127	33	0.1600	0.0945	0.3636	1.5
10	1xed:A	111	40	0.1600	0.1081	0.3000	1.7	1xed:B
11	3taz:B	433	51	0.2000	0.0346	0.2941	3.6	3tal:A, 3tal:B, 3taz:A
12	8ost:A	390	33	0.1600	0.0308	0.3636	3.7
13	6jmt:D	350	38	0.1200	0.0257	0.2368	4.2	6jmt:C, 6jmt:E, 6jmt:F, 6jmt:A, 6jmt:B
14	6iw6:A	438	33	0.1600	0.0274	0.3636	4.6	6iw6:B
15	8q7n:X	81	33	0.1467	0.1358	0.3333	6.1	8h6k:4I, 8h6l:4I, 8qo9:X, 8qpe:X, 8qzs:X
16	1deh:A	374	19	0.1200	0.0241	0.4737	6.5	1deh:B, 1hdx:A, 1hdx:B, 1hdy:A, 1hdy:B, 1hdz:A, 1hdz:B, 1hso:A, 1hso:B, 1hsz:A, 1hsz:B, 1ht0:A, 1ht0:B, 1htb:A, 1htb:B, 3hud:A, 3hud:B, 1u3t:A, 1u3t:B, 1u3u:A, 1u3u:B, 1u3v:A, 1u3v:B, 1u3w:A, 1u3w:B
17	6hqd:C	415	30	0.1600	0.0289	0.4000	7.3	6hqd:A, 6hqd:B
18	2ebv:A	57	20	0.1067	0.1404	0.4000	9.7

[Back]