SSASSQEYMAGMKNMHEKMMAAVNESNPDKAFAKGMIAHHEGAIAMAETELKYGKDPEMRKLAQDIIKAQKGEIEQMNKW
LDSHK
The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7vw1:B | 92 | 85 | 1.0000 | 0.9239 | 1.0000 | 3.91e-58 | 7vw1:A, 7vw2:B |
2 | 5ffc:A | 148 | 60 | 0.2941 | 0.1689 | 0.4167 | 1.05e-09 | 5fej:A, 5fej:B, 5fej:C, 5fej:D, 5ffd:A, 5ffe:A, 5ffe:B |
3 | 5ffc:A | 148 | 52 | 0.2706 | 0.1554 | 0.4423 | 1.25e-09 | 5fej:A, 5fej:B, 5fej:C, 5fej:D, 5ffd:A, 5ffe:A, 5ffe:B |
4 | 1yix:A | 265 | 43 | 0.1529 | 0.0491 | 0.3023 | 2.9 | 1yix:B |
5 | 2zwa:B | 683 | 52 | 0.1765 | 0.0220 | 0.2885 | 5.5 | 2zw9:A, 2zw9:B, 2zwa:A |
6 | 5t1p:D | 328 | 36 | 0.1529 | 0.0396 | 0.3611 | 6.4 | 5t1p:A, 5t1p:B, 5t1p:C |
7 | 5fsg:A | 661 | 19 | 0.1176 | 0.0151 | 0.5263 | 6.8 | |
8 | 6i2n:D | 336 | 19 | 0.1176 | 0.0298 | 0.5263 | 7.0 |