SSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLK
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6vme:C | 67 | 67 | 1.0000 | 1.0000 | 1.0000 | 2.80e-43 | 6vme:K, 6vme:L, 6vme:M, 6vme:N |
2 | 4omb:A | 298 | 46 | 0.2985 | 0.0671 | 0.4348 | 0.037 | 4omb:B, 4omb:C, 4omb:D |
3 | 1qs2:A | 401 | 44 | 0.1940 | 0.0324 | 0.2955 | 0.79 | |
4 | 2oas:A | 427 | 47 | 0.2239 | 0.0351 | 0.3191 | 4.1 | 2oas:B |
5 | 5xvd:S | 269 | 43 | 0.2239 | 0.0558 | 0.3488 | 4.2 | 6ehq:S, 6ehq:T, 6ehs:S, 6ehs:T, 6en9:S, 6en9:T, 6g7m:S, 6g7m:T, 6gam:S, 6gam:T, 6gan:S, 6gan:T, 7nem:S, 7nem:T, 6syo:SSS, 6syo:TTT, 6syx:SSS, 6syx:TTT, 6szd:SSS, 6szd:TTT, 6szk:SSS, 6szk:TTT, 7vxq:B, 7vxq:D, 5xvb:S, 5xvb:T, 5xvc:S, 5xvc:T, 5xvd:T |
6 | 8www:A | 501 | 29 | 0.2090 | 0.0279 | 0.4828 | 4.9 | 8www:B |
7 | 2dr1:A | 381 | 59 | 0.2687 | 0.0472 | 0.3051 | 5.5 | 2dr1:B |
8 | 8a22:Xd | 413 | 24 | 0.1642 | 0.0266 | 0.4583 | 5.8 | 8apn:Xd, 8apo:Xd |
9 | 2fio:A | 123 | 20 | 0.1493 | 0.0813 | 0.5000 | 8.3 | 2fio:B |