SRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFD
DHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDY
LDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPC
PDYCRNVLKGCLANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKV
NRGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMADRCWNGMARGRYLPEVMGDGLANQINNPEVEVD
ITKPDMTIRQQIMQLKIMTNRLRSAYNGN
The query sequence (length=429) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4ywt:B | 431 | 430 | 1.0000 | 0.9954 | 0.9977 | 0.0 | 4bwe:B, 4bwe:D, 4ywt:D |
2 | 4ywt:A | 411 | 428 | 0.9487 | 0.9903 | 0.9509 | 0.0 | 4bwe:A, 4bwe:C, 4ywt:C |
3 | 6xtz:A | 421 | 437 | 0.3193 | 0.3254 | 0.3135 | 1.12e-78 | |
4 | 2w16:B | 754 | 101 | 0.0699 | 0.0398 | 0.2970 | 0.14 | 2iah:A, 2w6t:B, 2w6u:B, 2w76:B, 2w77:B, 2w78:B, 1xkh:A, 1xkh:B, 1xkh:C |
5 | 7b5l:H | 423 | 127 | 0.0769 | 0.0780 | 0.2598 | 0.20 | 7b5n:H, 4kc9:A, 5udh:A |
6 | 5tte:B | 442 | 138 | 0.0816 | 0.0792 | 0.2536 | 2.1 | 7b5m:H, 2m9y:A, 1wd2:A |
7 | 8wm6:b | 194 | 40 | 0.0326 | 0.0722 | 0.3500 | 3.7 | 8wmj:b, 8wmv:b, 8wmw:b |
8 | 3fie:A | 407 | 122 | 0.0746 | 0.0786 | 0.2623 | 4.6 | 2a8a:A, 2a97:A, 2a97:B, 3fie:B, 3fii:A |
9 | 1lnx:A | 74 | 54 | 0.0373 | 0.2162 | 0.2963 | 8.6 | 1lnx:B, 1lnx:C, 1lnx:D, 1lnx:E, 1lnx:F, 1lnx:G |