SRRFRYNTKFPALVSYNKLPWEVVNHETPQFHMHVAPHYEQLLTLAASSPVPHIIGSKHIDVPREHRLRLLPGMLYLLDG
DTLPGEFTINRVLDPTALQYYGRLSSQIVTVEAVRMLVPDDLRLLCNCITFKGPLHLPVAPYASLASLRGASQGGSNCFT
LYHFVRPNRPPKELQLEKYYIHAPCVAPLSEFASNSDERGNWRPRLQAPKRTRRATPLPAYRPPQSYLMGLAERLAVVPG
GCFGRRSLMWGHWF
The query sequence (length=254) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6sga:DR | 254 | 254 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 6hiv:DR, 6hiw:DR, 6hiy:DR, 7pua:DR, 7pub:DR, 6sgb:DR |
2 | 7aor:as | 252 | 254 | 0.7244 | 0.7302 | 0.7244 | 2.23e-142 | |
3 | 5xvu:A | 321 | 46 | 0.0433 | 0.0343 | 0.2391 | 2.2 | 5xvu:B, 5xvu:C |
4 | 7eoz:A | 482 | 43 | 0.0669 | 0.0353 | 0.3953 | 4.5 | 7eoz:B |
5 | 8j9f:D | 749 | 67 | 0.0787 | 0.0267 | 0.2985 | 7.9 | 8j9f:A, 8j9f:B |