SRQPIPSLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLA
LNDCHAEIISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHERKARGQLR
TKIESGEGTIPVLLTMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNK
PLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVY
HESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLT
The query sequence (length=362) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8e0f:B | 454 | 383 | 0.9917 | 0.7907 | 0.9373 | 0.0 | 6d06:A, 6d06:D, 8e0f:A, 8e4x:A, 8e4x:B, 5ed1:A, 5ed1:D, 5ed2:A, 5ed2:D, 5hp2:A, 5hp2:D, 5hp3:A, 5hp3:D, 7kfn:A, 7kfn:D, 2l2k:B, 6vff:A, 6vff:B, 1zy7:A, 1zy7:B |
2 | 4kzk:A | 301 | 95 | 0.0801 | 0.0963 | 0.3053 | 0.13 | |
3 | 8pcx:A | 232 | 49 | 0.0442 | 0.0690 | 0.3265 | 2.9 | 8bjo:A, 8bxz:A, 8p6o:A, 8pc3:A, 8pc8:A, 8pdt:A, 8ped:A, 8qli:A, 8r43:A, 8rbn:A |
4 | 4rdr:A | 706 | 30 | 0.0359 | 0.0184 | 0.4333 | 4.1 | |
5 | 4rdt:A | 635 | 113 | 0.0884 | 0.0504 | 0.2832 | 5.5 | 4rdt:B |
6 | 4ywo:A | 444 | 45 | 0.0414 | 0.0338 | 0.3333 | 8.0 |